SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018108 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018108
Domain Number 1 Region: 3020-3278
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-56
Family YWTD domain 0.00000225
Further Details:      
 
Domain Number 2 Region: 1267-1532
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-53
Family YWTD domain 0.00000197
Further Details:      
 
Domain Number 3 Region: 1884-2141
Classification Level Classification E-value
Superfamily YWTD domain 3.27e-45
Family YWTD domain 0.0000154
Further Details:      
 
Domain Number 4 Region: 3866-4148
Classification Level Classification E-value
Superfamily YWTD domain 5.49e-45
Family YWTD domain 0.00000725
Further Details:      
 
Domain Number 5 Region: 1578-1834
Classification Level Classification E-value
Superfamily YWTD domain 6.8e-43
Family YWTD domain 0.0000317
Further Details:      
 
Domain Number 6 Region: 535-792
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-40
Family YWTD domain 0.00000706
Further Details:      
 
Domain Number 7 Region: 202-472
Classification Level Classification E-value
Superfamily YWTD domain 6.28e-39
Family YWTD domain 0.0000896
Further Details:      
 
Domain Number 8 Region: 2192-2463
Classification Level Classification E-value
Superfamily YWTD domain 1.09e-35
Family YWTD domain 0.0000305
Further Details:      
 
Domain Number 9 Region: 2926-3012,3271-3332
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.95e-24
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 10 Region: 111-191,468-523
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.24e-19
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 11 Region: 3769-3863,4149-4187
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000314
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 12 Region: 1171-1259,1533-1573
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000565
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 13 Region: 848-888
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.00013
Further Details:      
 
Domain Number 14 Region: 3561-3600
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.00057
Further Details:      
 
Domain Number 15 Region: 3603-3638
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000236
Family LDL receptor-like module 0.0005
Further Details:      
 
Domain Number 16 Region: 3360-3404
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000314
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 17 Region: 3645-3689
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000034
Family LDL receptor-like module 0.00097
Further Details:      
 
Domain Number 18 Region: 888-930
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000038
Family LDL receptor-like module 0.00072
Further Details:      
 
Domain Number 19 Region: 2684-2720
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000497
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 20 Region: 3522-3561
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000511
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 21 Region: 973-1011
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000602
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 22 Region: 929-968
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000785
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 23 Region: 3478-3519
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000118
Family LDL receptor-like module 0.00077
Further Details:      
 
Domain Number 24 Region: 1013-1051
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.0001
Further Details:      
 
Domain Number 25 Region: 2549-2590
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 26 Region: 25-64
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 27 Region: 2589-2629
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000249
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 28 Region: 2723-2757
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 29 Region: 2763-2797
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000034
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 30 Region: 1061-1105
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000537
Family LDL receptor-like module 0.00023
Further Details:      
 
Domain Number 31 Region: 3442-3477
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000055
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 32 Region: 2895-2936
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000641
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 33 Region: 2845-2884
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.00063
Further Details:      
 
Domain Number 34 Region: 3322-3356
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 35 Region: 3402-3440
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 36 Region: 2808-2843
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000301
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 37 Region: 1838-1887
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000101
Family EGF-type module 0.017
Further Details:      
 
Domain Number 38 Region: 3690-3724
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000144
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 39 Region: 3730-3769
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000314
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 40 Region: 74-109
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000615
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number 41 Region: 1104-1139
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000668
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 42 Region: 1142-1180
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000772
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 43 Region: 2146-2188,2453-2535
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000108
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 44 Region: 2647-2679
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000034
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 45 Region: 4201-4236
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000027
Family EGF-type module 0.029
Further Details:      
 
Domain Number 46 Region: 806-851
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000798
Family EGF-type module 0.026
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000018108
Domain Number - Region: 4274-4310
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000132
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 4239-4273
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000212
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 4371-4413
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000335
Family Integrin beta EGF-like domains 0.054
Further Details:      
 
Domain Number - Region: 4311-4344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00779
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018108   Gene: ENSTNIG00000015058   Transcript: ENSTNIT00000018332
Sequence length 4549
Comment pep:known_by_projection chromosome:TETRAODON8:9:4018179:4064858:-1 gene:ENSTNIG00000015058 transcript:ENSTNIT00000018332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRPELLLAAVSHGSHAPKADDHPKTCSSKQFVCKDQVTCISKGWRCDGEKDCPDGSDESP
DICKPRRSHSKVNQCPVNEHGCLDPEVCIPMSRLCDGVPDCTDGWDEGPHCREQAPACIA
QRCQFNCSVTHDGPRCYCSAGYEVTADGRTCKDFNECNVYGTCSQTCSNTEGSYTCSCVE
GYLLQPDNRSCKAKNDPVDRLPMLLIANLHDIRCTTLSGALSRLHAITTKQTMAMDFIYA
DETVCWIDVGETPAATHLKCASIPDLKTVTNIRTINITLSLHHVEQMAIDWLTKNFYFVD
DVDDRVFVCNKDGQTCVTLLDQDLYNPKGIALDPAMGKVFFTDYGSTPRVERCDMDGQNR
TKLVDTKIVFPHGITLDLVNRLVYWADAYLDYIEVVDYEGKNRHTIIQGLLIEHLYGLTV
FENYLYATNSDEGNLNPKTSVIRVNRFNSSDFQVVTRVDRGAALHVYHQRRQPQVRSHAC
TTDQFGKAGGCSDICLLSNSHKTRTCRCRSGFSLGSDGKSCKKPDHELFLVYGKGRPGII
RGMDMNAKVPDEYMIPIENLMNPRALDFHAASEYIYFADATSYIIGRQKIDGTERDTILK
EGIHTVEGIAVDWMGGNLYWTDDGPKKTISVARLEKASQTRKTLIEGKMSHPRAIVVDPQ
HGWMYWTDWEEDPSESNRGKIKKAWMDGSHHQIFLTSKTVLWPNGLSLDIPQGILYWVDA
YYDRIEMVYLNTTERKVVYEGQELTHAFGLCHYKQFLFWNEYRGGSIYKLDQVTKTVTLL
RNERPPIFEIRVYDAHQQQGLGSNACRVNNGGCSSLCLAIPDGRSCGCADDQILDGDNVT
CKANPSYVNPPQCQPGEFACKNNRCIQERWKCDGDNDCLDNSDEAPELCHQHTCPADRFK
CQNNRCIPLRWLCDGDNDCGNDEDESNTTCSARTCPPNQYPCASGRCIPISWTCDLDDDC
GDRSDEPDSCAYPTCFPLTQFTCANGRCININWRCDNDNDCGDNSDEAGCSHSCSSVQFK
CNSGRCIPEYWTCDGDNDCGDYSDETHANCTNQATRPPGGCHVDEFQCRMDSLCIPMRWR
CDGDTDCMDLSDERNCEGVTHMCDPAVKFSCKDSARCISKAWVCDGDSDCEDNSDEDNCD
ALVCKLSHHTCATNDSICLPAEKLCDGTDDCPDGSDEKLCDLCALDNGGCSHNCTIIPGE
GFMCSCPLGMELGADNKTCQIQSFCAKHLKCSQKCEQEKSSVKCSCYEGWELEADMESCK
STDPFKPFIIFSNRHEIRRIDLHKGEFSVLVPGLRNTIALDFHLSESTLYWTDVVEDKIY
RGKLSENGALTSFEVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTMRTTLL
AGEVEHPRAIALDPRDGILFWTDWDASLPRIEAASMSGEGRRTIHRETGSGGWPNGLTVD
YMERRIVWIDARSDAIYSAMYDGSGLIEVLRGHEYLSHPFAVTMYGGEVYWTDWRTNTLA
KANKWTGHNVTVVQRTNTQPFDLQVYHPSRQPKAPNPCASSPCSHLCLINFNQTFSCACP
HLMKLQPDKRTCKESRKFLLYARQIEIRGVDIDNPYYNYIISFTVPDIDNVTAVDYDAVE
HRIYWSDVRTQTIKRAFINGTGVETVVSADLPNAHGLAVDWVSRNLFWTSYDANKKQINV
ARLDGSFKNAVIQGLDKPHCLVLHPILGKLYWTDGDNISMANMDGSNHTTLFTGQKGPVG
LSIDYEKDQLYWISSGNGTISRCQLDGTKLEIMEGVKGKLSKATALAIMGDKLWWADQGS
DQIGTCDKKDGGNWKVMRNNTSPMMHMRIYDESAQKSGINLCSNNNGDCSQLCLPTSPTT
RACMCTAGYSLKSGQQSCEGMGSFLLFSVHEGIRGIPLDPADKSDALVPVSGTSLAVGID
FHAENDTIYWVDMGLSTISRAKRDQTWREDVVTNGIGRVEGITVDWIAGNIYWTDQGFDV
IEVARLNGSFRYVVISQGLDKPRAITVHPSKGYLFWTEWGQYPRIERSRLDGSQRLVLVN
VSISWPNGISIDYEEGLLYWCDARTDKIERINLETGENRELVLANNNMDMFAVSVFEEHI
YWSDRTHANGSIKRGSKDNATDAVQLRTGIGVQLKDIKVFNKARQQGTNVCRNNNGGCEQ
LCLYRGNGERTCACAHGMLAEDNRSCRDYDGYLLYSERTILKSIHLSDETNLNAPIKPFE
DPDHMKNVIALSFDYHGGGGKGSNRIFFSDIHFGNIQQINDDGTDRKIVVDNVGSVEGLA
YHRGWDTLYWTSYTTSTITRHTVDQSRTVAYNRDTVVNMSAEDHPRAFVLDECQDLMFWT
NWNEQAPSIMRASLNGANVLVIIGSDIKTPNGLAIDHRAEKLYFSDATLDKIERCEYDGS
SRYVLLKNEPVHPFGLAVYGDYIFWTDWVRRAVLRADKYTGGDMKVLRADIPQQPMGIVA
VNDTNNCEFSPCRTNNGGCQDLCLPTSDGRVNCSCRGDRHLLEDNTCSPLNMSCGSVDGF
ECGNGDCINYSLTCDGMAHCKDKSDEKQSYCANRICKKGYRRCINGRCIGHQFWCDGTDD
CGDHSDELPCNMTLCKPGEFQCKDGSCISNFSRCDQVVNCEDASDEMNCQSTDCSRFFRL
GVKGASFQSCERTTLCYLSSWVCDGNNDCGDFSDEKNCPDKRKLKCPVNFFACPSGRCIP
MSWTCDKENDCENGADETHCDKFCTSTQFECANHRCISSHWVCDGSDDCGDGSDEDQKCK
SKTCSPEAFQCPGSHMCVPQRWKCDGDKDCPDGADESVKAGCMYTNSTCDPENEFMCQNR
QCIPKHFVCDLDVDCSDGSDESPECEYPTCGPDEFRCANGRCLNQKKWECDGEFDCHDHS
DEAPKNPRCTSSERTCNDSAFTCLNGNCLNETLLCDRNDDCGDGSDELNCFINECLNSKL
SGCSQLCDDLKIGYKCRCHPGFQLKRDGKTCVDVDECLTTYPCSQRCINTHGSFHCLCVD
GFQPSPNDPNICLASVEEEPYLIFANRYYLRKLNLDGSNYTLIKQGLNNAVALDFHYAEQ
MIYWTDVTTQGSMIRRMHMNGSNMEVLHRTSLSNPDGLAVDWVGGNLYWCDKGRDTIEVS
KLNGAYRTVLVNSGLREPRALAVDVRYRYLYWSDWGDNPHIGRIGMDGSNRSVIVEEKIT
WPNGLTLDFINDRIYWADAREDYIEFASLDGTNRHTVLNHDIPHIFAMTLFEEYIYWTDW
ETKSINRAHKTQGTNKTTLISTLHRPMDVHIYHPYRQPEVLNHPCQTNNGGCSNLCLLSP
GGGYKCACPTNFYLASDQRTCMSNCTASQFVCKNDKCIPFWWKCDTEDDCGDRSDEPADC
PEFKCRPGQFQCGTGICTNPAYICDGDNDCQDNSDEANCDIHVCLPSQFKCSHPSRCIPG
IFRCNGQDNCGDGEDEKDCPEVTCAPTQFQCAITKRCIPRVWVCDRDNDCVDGSDEPANC
TQMTCGVDEFRCKDSGRCIPARWKCDGEDDCGDASDEPKEECAERTCEPYQFRCKNNRCV
PGRWQCDYDNDCGDNSDEDKCMPRQCSESEFACTNGRCIAGRWKCDGDHDCADGSDEHGC
DLKCDTDHFQCNNGHCIPIRWRCDADPDCLDGSDEENCGSATERHCPADEFQCNNTLCKP
LAWKCDGEDDCGDNSDENPEQCRKFQCPPTRAFRCQNDRVCLQVSKRCDGVNNCGDNSDE
LNCPTETPPAVPTCEKDEFLCANHRCISSTLRCNLFNDCEDFGSDEIGCKTDTKLNDCRS
NRTHCGDGDEAHCVTNGTDSFCSCKPGFQKIGHRTCGDKNECLQFGVCSHSCNNTKGSYK
CSCHKYFTRISDTCKADNINSSRQILYIADDNEIRSLDPGMPDWRYEQTFQGDASVRIDA
MDVHVKTNRIFWTNWHTGRISTYELQGPSLSATSSNSHRHRRQSEGRVTDLQIKELKMPR
GIAVDWVAGNLYWTDSGRDVIEVAQMSGQNCKTLISGMIDEPYAIVVNPQRGTMYWADWG
NHPKIETAAMDGTLRQTLVHENIQWPTGLAVDYFNERLYWADAKLSVIGSVRLDGSDPVI
SVSGLKNSCPDLLHPFSIDIFEDYIYGVTYINNIVFRVNKFGKGKMENLTTGINHASDIV
LHHRYKQPEMTNPCDRKKCEWLCLLSPSGPVCTCPNKYVADNGTCVEKPVPTQSPFSPPS
EPCDIQCLNGGSCFLNARQVAKCRCQPSYIGERCEINQCRDYCKNGGTCTASHAGVPTCR
CPKGFTGPTCSRQTCQDYCQNGGSCSVSMGNQPTCSCPSEYQGDRCQYTTCEGFCHNSGT
CLQTSNGTKLCLCSNQYVGHQCELDKCQFCGTGKCFTSPSSEVTCSCPNGQIQPSCFTCL
NYCSRGQCSVDSRTLLPQCKCPAGWSGYTCEIAAAPVDSSASGGSTASIVVPVLLLLLLA
LLAVGAVLWYRRRMRGAKGFQHHRMTNGAMNVEIGNPAYKIYEGDPDDDAGELLDSDFAL
DPDKPTNFTNPVYATLYMGAHNSRNSLASTDEKKELLSQADEDLSDPLA
Download sequence
Identical sequences H3DC65
99883.ENSTNIP00000018108 ENSTNIP00000018108 ENSTNIP00000018108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]