SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018110 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018110
Domain Number 1 Region: 61-319
Classification Level Classification E-value
Superfamily YWTD domain 5.75e-57
Family YWTD domain 0.00000225
Further Details:      
 
Domain Number 2 Region: 903-1182
Classification Level Classification E-value
Superfamily YWTD domain 1.1e-45
Family YWTD domain 0.00000699
Further Details:      
 
Domain Number 3 Region: 1-57,312-373
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.42e-20
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 4 Region: 602-641
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000654
Family LDL receptor-like module 0.00057
Further Details:      
 
Domain Number 5 Region: 644-679
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000785
Family LDL receptor-like module 0.0005
Further Details:      
 
Domain Number 6 Region: 399-440
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000942
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 684-728
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000102
Family LDL receptor-like module 0.00097
Further Details:      
 
Domain Number 8 Region: 563-602
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 9 Region: 519-559
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000471
Family LDL receptor-like module 0.00077
Further Details:      
 
Domain Number 10 Region: 480-517
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000124
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 11 Region: 363-397
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000524
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 12 Region: 443-481
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 13 Region: 729-762
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000628
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 14 Region: 767-806
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000144
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 15 Region: 1235-1270
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000355
Family EGF-type module 0.029
Further Details:      
 
Domain Number 16 Region: 1308-1344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000185
Family EGF-type module 0.024
Further Details:      
 
Domain Number 17 Region: 1273-1307
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000373
Family EGF-type module 0.017
Further Details:      
 
Domain Number 18 Region: 855-891
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000375
Family EGF-type module 0.012
Further Details:      
 
Domain Number 19 Region: 1405-1447
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000393
Family Integrin beta EGF-like domains 0.054
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000018110
Domain Number - Region: 1345-1378
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00135
Family EGF-type module 0.038
Further Details:      
 
Domain Number - Region: 811-862
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00996
Family EGF-like domain of nidogen-1 0.08
Further Details:      
 
Domain Number - Region: 1190-1221
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0782
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018110   Gene: ENSTNIG00000015058   Transcript: ENSTNIT00000018334
Sequence length 1581
Comment pep:known_by_projection chromosome:TETRAODON8:9:4018179:4028118:-1 gene:ENSTNIG00000015058 transcript:ENSTNIT00000018334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CRCHPGFQLKRDGKTCVDVDECLTTYPCSQRCINTHGSFHCLCVDGFQPSPNDPTMCSRE
PYLIFANRYYLRKLNLDGSNYTLIKQGLNNAVALDFHYAEQMIYWTDVTTQGSMIRRMHM
NGSNMEVLHRTSLSNPDGLAVDWVGGNLYWCDKGRDTIEVSKLNGAYRTVLVNSGLREPR
ALAVDVRYRYLYWSDWGDNPHIGRIGMDGSNRSVIVEEKITWPNGLTLDFINDRIYWADA
REDYIEFASLDGTNRHTVLNHDIPHIFAMTLFEEYIYWTDWETKSINRAHKTQGTNKTTL
ISTLHRPMDVHIYHPYRQPEVLNHPCQTNNGGCSNLCLLSPGGGYKCACPTNFYLASDQR
TCMSNCTASQFVCKNDKCIPFWWKCDTEDDCGDRSDEPADCPEFKCRPGQFQCGTGICTN
PAYICDGDNDCQDNSDEANCDIHVCLPSQFKCSHPSRCIPGIFRCNGQDNCGDGEDEKDC
PEVTCAPTQFQCAITKRCIPRVWVCDRDNDCVDGSDEPANCTQMTCGVDEFRCKDSGRCI
PARWKCDGEDDCGDASDEPKEECAERTCEPYQFRCKNNRCVPGRWQCDYDNDCGDNSDED
KCMPRQCSESEFACTNGRCIAGRWKCDGDHDCADGSDEHGCDLKCDTDHFQCNNGHCIPI
RWRCDADPDCLDGSDEENCGTERHCPADEFQCNNTLCKPLAWKCDGEDDCGDNSDENPEQ
CRKFQCPPTRAFRCQNDRVCLQVSKRCDGVNNCGDNSDELNCQTPPAVPTCEKDEFLCAN
HRCISSTLRCNLFNDCEDFGSDEIGCKTDTKLNDCRSNRTHCGDGDEAHCVTNGTDSFCS
CKPGFQKIGHRTCGDKNECLQFGVCSHSCNNTKGSYKCSCHKYFTRISDTCKADNINSSR
QILYIADDNEIRSLDPGMPDWRYEQTFQGDASVRIDAMDVHVKTNRIFWTNWHTGRISTY
ELQGPSLSATSSNSHRHRRQSEGRVTDLQIKELKMPRGIAVDWVAGNLYWTDSGRDVIEV
AQMSGQNCKTLISGMIDEPYAIVVNPQRGTMYWADWGNHPKIETAAMDGTLRQTLVHENI
QWPTGLAVDYFNERLYWADAKLSVIGSVRLDGSDPVISVSGLKNNLLHPFSIDIFEDYIY
GVTYINNIVFRVNKFGKGKMENLTTGINHASDIVLHHRYKQPEMTNPCDRKKCEWLCLLS
PSGPVCTCPNKYVADNGTCVEKPVPTQSPFSPPSEPCDIQCLNGGSCFLNARQVAKCRCQ
PSYIGERCEINQCRDYCKNGGTCTASHAGVPTCRCPKGFTGPTCSRQTCQDYCQNGGSCS
VSMGNQPTCSCPSEYQGDRCQYTTCEGFCHNSGTCLQTSNGTKLCLCSNQYVGHQCELDK
CQFCGTGKCFTSPSSEVTCSCPNGQIQPSCFTCLNYCSRGQCSVDSRTLLPQCKCPAGWS
GYTCEIAAAPVDSSASGTASIVVPVLLLLLLALLAVGAVLWYRRRMRGAKGFQHHRMTNG
AMNVEIGNPAYKIYEGDPDDDAGELLDSDFALDPDKPTNFTNPVYATLYMGAHNSRNSLA
STDEKKELLSQADEDLSDPLA
Download sequence
Identical sequences H3DC67
ENSTNIP00000018110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]