SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018148 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018148
Domain Number 1 Region: 81-282,337-425,455-480
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 7.03e-55
Family Diacylglycerol kinase-like 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018148   Gene: ENSTNIG00000015094   Transcript: ENSTNIT00000018372
Sequence length 493
Comment pep:known_by_projection chromosome:TETRAODON8:9:3478036:3481021:-1 gene:ENSTNIG00000015094 transcript:ENSTNIT00000018372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVPVSEVVGVEEGRVHILPKKSVEDTDKDFTVFYVKRCRSGGSYGLLWTLGRTQFSCPSR
VLRDQWIKDLRAAVKNYGPLRPRRLLVFINPFGGKKKGRKIYYSLVAPLFELAGISSHVI
VTERANQARDHLLKKDLTGFDGVVCVGGDGMFSEILHGLIGRTQQEAGICENDPSAALQP
CSLHIGIIPAGSTDCVCYATVGVIDPVTSALHIVIGDSQPLDVCSVHQALTHRYSVSLLG
YGFYGDVLAESEKHRWMGPLRYDFSGTMVYLCNRSYAGVVQYIPADPVLSSPRDRTRCLS
GCSVCSRSTDRLVRHPSDSGSLHKSHYGHFNSHSEDEWVTVEGRFRCVSLTCMSSSCPRS
PLGLSPSAHLADGTGDLILVWNTNPLGFLKYLYRHTGAQDQFDLPFVEVHRVTAVRFSLP
SSKEEGEYEEIDKQKTPDSFLCGLCCATPPPVSVWNCDGEILPVTEVFCRIHGQLLRLYA
RGIEDQARHNCSE
Download sequence
Identical sequences H3DCA5
ENSTNIP00000018148 99883.ENSTNIP00000018148 ENSTNIP00000018148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]