SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018163 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018163
Domain Number 1 Region: 27-188
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.33e-47
Family Ankyrin repeat 0.00011
Further Details:      
 
Domain Number 2 Region: 244-287
Classification Level Classification E-value
Superfamily SOCS box-like 0.000011
Family SOCS box-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018163   Gene: ENSTNIG00000015108   Transcript: ENSTNIT00000018387
Sequence length 289
Comment pep:known_by_projection chromosome:TETRAODON8:9:3270720:3271801:1 gene:ENSTNIG00000015108 transcript:ENSTNIT00000018387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSTMWYIMQSIQSKYSLSERLIRTIAAIRSFPHDNVEDLIRKGADVNRMHGTLKPLHCA
CMVADADCVELLLHHGAEVNALDGYNRTALHYAAEKDESCVELLLEYGAQPDALDGNKDT
PLHWAAFKDNPECVRALLENGACPNARDYNNDTPLSWAAMKGNLESVKVLLDYGAQVHVT
NLKGQTPISRLVALLARGLGTEQEEECLDLLCQAAGRFEIRRADGTLPRELNKDPQLLAR
LTSMMAQAPTLRSLARCAVRQSLGVQFLPTAVKDLPLPETIKEYLLLRD
Download sequence
Identical sequences H3DCC0
ENSTNIP00000018163 99883.ENSTNIP00000018163 ENSTNIP00000018163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]