SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018176 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018176
Domain Number 1 Region: 184-297
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.34e-23
Family Synaptotagmin-like (S variant) 0.018
Further Details:      
 
Domain Number 2 Region: 19-128
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.28e-20
Family Synaptotagmin-like (S variant) 0.029
Further Details:      
 
Domain Number 3 Region: 327-507
Classification Level Classification E-value
Superfamily vWA-like 4e-17
Family Integrin A (or I) domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018176   Gene: ENSTNIG00000015121   Transcript: ENSTNIT00000018400
Sequence length 588
Comment pep:known_by_projection chromosome:TETRAODON8:9:3119738:3165339:-1 gene:ENSTNIG00000015121 transcript:ENSTNIT00000018400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKVEATATVRDFDPISGSVPATKVEITVSCRNLLDRDTFSKSDPLVVLYTQGVECKQWR
EFGRTEVIDNTLNPDFVRKFILDYFFEEKQNLRFDVYDIDSKSPDLAKHDFLGQVHCTLG
EIVGSPASRLEKSLGFGSFFLGPHLFTPPPPRLSGGIPGKKCGTIVLSAEELIICRQDCA
TMQFCANKLDKKDFFGKSDPFMVFYRSNEDGTFTICHKTEVVKNTLNPVWQAFSIPVRAL
CNGDYERTIKAEIYDWDRDGSHDFIGEFTTSYKELCRGQGQSNVYEVMNAKKKLKKKRYI
NSGTVSLLSFSVESEHTFLDYIKGGTQIHFTVAIDFTASNGNPSQSTSLHYMNPYQMNAY
AMALKAVGEIIQDYDSDKMFPALGFGAKLPPDGRVSHEFPLNGNTENPYCNGMEGILEAY
HQSLKTVQLYGPTNFSPVVNHVARYAAAVQDGSQYFVLLIITDGVISDMAQTKEAIVNAA
KLPMSIIIVGVGQAEFDAMVELDGDDIRISSRGKMAERDIVQFVPFRDYMDRTGNHVLSM
ARLAKDVLAEIPDQLISYMKSRAIKPSPVPPAYSTGTQPPSNPVHYYI
Download sequence
Identical sequences H3DCD3
ENSTNIP00000018176 99883.ENSTNIP00000018176 ENSTNIP00000018176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]