SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018236 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018236
Domain Number 1 Region: 330-494
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.24e-45
Family SPRY domain 0.00032
Further Details:      
 
Domain Number 2 Region: 110-174
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000198
Family B-box zinc-binding domain 0.001
Further Details:      
 
Domain Number 3 Region: 9-59
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000024
Family RING finger domain, C3HC4 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018236   Gene: ENSTNIG00000015180   Transcript: ENSTNIT00000018461
Sequence length 494
Comment pep:novel chromosome:TETRAODON8:9:2198435:2199916:-1 gene:ENSTNIG00000015180 transcript:ENSTNIT00000018461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQKGFETEQRTFFCFICLRCPDNPVVIPCGHSYCTDCIKAHRDCYSCPQCGQTFSTRPD
LPTSTDVLCDICMDLKLKATTFCLVCLISFCEKHIQPHVESPAYKKHKLVQASRSLQENI
CSDHNELMKLFCRSDQQLICYLCSVEEHKGHITVSAAAEVTEKKKGVDTSRQNLQERIQV
REGELKALREETEAVNAAADKTAKDSEEILTRLISEVKQKIRSEQEAHLIQLKELQEKLD
QEISELKSRDAELKILSQTEDDGRFLRDYASLPGLGQATAVRRPPRGFEAVTAAVSEFRD
KLQEALKRERTNVSLTQVEVPLSEPEPGTREDFLKHFDQITLDPNTINKWLFLSEDYRSA
TLIRQAESYPLHPDRFSDWHQVLSTKILTGCCYWEVEMTGAGICVAVSYKDIRRAWRSCE
SGFGLNDKSWTLNCYNGIYDFWHDNVRTPVSGPRSSRVGVFLDYSAGVLSFYSVSESTMT
LLHRTQTTFTQPLY
Download sequence
Identical sequences H3DCJ3
99883.ENSTNIP00000018236 ENSTNIP00000018236 ENSTNIP00000018236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]