SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018261 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018261
Domain Number 1 Region: 162-463
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 2.88e-51
Family Integrin alpha N-terminal domain 0.0000681
Further Details:      
 
Domain Number 2 Region: 2-189
Classification Level Classification E-value
Superfamily vWA-like 4.6e-49
Family Integrin A (or I) domain 0.0000119
Further Details:      
 
Domain Number 3 Region: 610-761
Classification Level Classification E-value
Superfamily Integrin domains 3.24e-21
Family Integrin domains 0.0064
Further Details:      
 
Domain Number 4 Region: 463-608
Classification Level Classification E-value
Superfamily Integrin domains 0.000000000000408
Family Integrin domains 0.0096
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000018261
Domain Number - Region: 838-924
Classification Level Classification E-value
Superfamily Integrin domains 0.068
Family Integrin domains 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018261   Gene: ENSTNIG00000015204   Transcript: ENSTNIT00000018486
Sequence length 1002
Comment pep:known_by_projection chromosome:TETRAODON8:15:7084769:7091676:1 gene:ENSTNIG00000015204 transcript:ENSTNIT00000018486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DCPSQADVAFLLDGSGSVNSYDFDRMKTFVSTLVRSFKGRDTKFAIVQFSNRFRIESSFT
DQSNLERNINNIVQLSGGTYTASAINFVVNNVFVASGGSRENVGKVLIVITDGESQENQQ
LPGAAQAAEAKRIVRFAIGVGGAFTKQSAIQELNTIASSPPENYVFQVDNFAALDKIRES
LQEKIFSIEGSQTSGQLLKMEMSQVGFSAAYDSEGFLLAAVGANQWKGGFLKYKTRDSRT
EPFEPSTVDPDSYLGYSMAVAKTPKGSLAIVGAPRYRHVGAVIAVQRSGASQNINPYPKQ
TGEYFGAAVCTMDVDGDTYTDLILVSAPMFVDKDREGRVYIYTLSGLSVNLQDYYLRGSA
SNAGRFGSSLAVLPDLNADGFNDLAIGAPLENNGQGSIYIFHGNGRQRISQTYSQRISAS
DVRPGLKFFGISISQSSFDLSKDGLPDLAVGSKGTVVLLRSKPIVMIKADVSYSPKQIGT
QNSNCSVPPEIKAQICFFMTSTFNQAQARVNFTFALDSLRDDFTSRAFISGKQRIGTGTS
NLALNRRQCVDMTFFVKACPEDALNELLNQLNFSFEGVPSNTNLRPSLAPQAQTSIHPSL
LQFEINCGIDNKCVDNLNLDFNFTRTLEVKVGIDDLLNVTVSVENSEENSYNSHVLLTYP
AGLSYRKVTVLQVKHQFALVKSFQLRTYLFLYGRIECNSVDSENGVQRGKTDCTIDKPIF
KSKSKVYFIVSYGIEPNSKFDEKIFITANATSQNEEHSNLSKLYSIKWIDVKYSIFVTLE
SSQSYSNFTFGNDDLQKPVLQRLTVTNDIRALNFTTVIRVPMQLGDRNIWVDSSKLQISD
CHRDNDEEPALTDFVTEIQKTKRVDCTVAKCGVFKCSHFMQGTESRVYNISANLSSGWIQ
QIGLNSAKFLLTSAASVDYDTKRYCSFSLRVIFFSTIPQIEAEVEVYPLPDFTQEIIGGS
LGGLALLVLITAVLYKIGFFKSKYKEMIDGTGEGAENPEAGA
Download sequence
Identical sequences H3DCL8
99883.ENSTNIP00000018261 ENSTNIP00000018261 ENSTNIP00000018261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]