SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018262 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018262
Domain Number 1 Region: 67-255
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.63e-52
Family Astacin 0.00013
Further Details:      
 
Domain Number 2 Region: 424-591
Classification Level Classification E-value
Superfamily TRAF domain-like 1.21e-34
Family MATH domain 0.0011
Further Details:      
 
Domain Number 3 Region: 262-426
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.32e-22
Family MAM domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018262   Gene: ENSTNIG00000015205   Transcript: ENSTNIT00000018487
Sequence length 636
Comment pep:known_by_projection chromosome:TETRAODON8:15:7079447:7085186:-1 gene:ENSTNIG00000015205 transcript:ENSTNIT00000018487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLWSVKYCLLLLAWGLAAAELTGETETDVDEGHDWDIPNINGVAGVDLLEGDIEQDKTSS
RNTIIGEKYRWPTTVPYYLEDSLDMNAKGVVLKAFDQYRLKTCIDFTPWKGEQNYISVFK
GSGCFSSVGNQHVGKQRLSIGKNCDRLGTVEHEFLHALGLWHEQSRADRDDYVQIMWDQI
EPGKEHNFRTRDDTVSSALGVPYDYSSVMHYSKTSFSRSSEPTIVTKIPHFLDVIGQRMG
FSAGDLSKLNRLYKCTKSSTFVESCSFEEDNICGMIRGSGNRKWERRASVDGGPQTDFTN
MGQCKGKGFFMHFSTASAEPADRASLETQWLYPKSGVQCLQFFLHRNGASDDVLNIWVRE
YDKAQGSRRTLFRTIRAGGVGGSWELHAITLNMTQKARVVFEGISGKGPSAGGFSLDDIN
LSSVKCPEHVWHVRNITGLLATTPARRKEYSPRFLSSTGYSFQVGVYLNGESSRPGYMAV
YLHLTSGPNDHKLRWPCPWHQGTMALLDQQSDIRQQMSMHRMVTTDPKKTSSDGTEFYWD
DPRKVGSKITASDGSFYYRGPGYGTSTFIAHSRLRSRNFLKGDDAFFLLSFEDISALLVS
QPLLGLRSTSTVTWRRRRLLRELRREPLQLRWWSRL
Download sequence
Identical sequences H3DCL9
ENSTNIP00000018262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]