SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018274 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018274
Domain Number 1 Region: 203-341
Classification Level Classification E-value
Superfamily Cadherin-like 1.05e-30
Family Cadherin 0.00000691
Further Details:      
 
Domain Number 2 Region: 433-559
Classification Level Classification E-value
Superfamily Cadherin-like 3.53e-24
Family Cadherin 0.00063
Further Details:      
 
Domain Number 3 Region: 322-437
Classification Level Classification E-value
Superfamily Cadherin-like 2e-19
Family Cadherin 0.00023
Further Details:      
 
Domain Number 4 Region: 112-207
Classification Level Classification E-value
Superfamily Cadherin-like 4.85e-16
Family Cadherin 0.00000862
Further Details:      
 
Domain Number 5 Region: 1-126
Classification Level Classification E-value
Superfamily Cadherin-like 7.07e-16
Family Cadherin 0.0013
Further Details:      
 
Domain Number 6 Region: 554-650
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000257
Family Cadherin 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018274   Gene: ENSTNIG00000015216   Transcript: ENSTNIT00000018499
Sequence length 853
Comment pep:known_by_projection chromosome:TETRAODON8:15:6883634:6899385:-1 gene:ENSTNIG00000015216 transcript:ENSTNIT00000018499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRFLDCGRGGPVRLESNNPSDFWIEADGVVYAARSGQRSPQHAPTLLIKAIDSTTQQQWM
TQVRMVPSPLSSQQVQKAPVPAVPDKDLMEISFPSRKSDSQLKRMKRDWVIPPINVPENS
RGPFPQELVRIRSDHDKTRALRYSVTGPGADQPPTSIFIIDPISGELSVNKPLDREHIPN
FHLKAHAVDLNGNQLENPIDLAINVIDMNDNRPEFTHQIWNGTVPEGSKPGTFVMTVTSV
DKDDPKTANGMLRYKILSQTPESSSNMFTINNKTGGIITVAAGLDREKVPQYTLIIQATD
MEGNPMYGLSNTATAVIKITDVNDNPPEFTTAMFYGEVRENRVNVIVANLTVTDKDQPNT
PAWNAVYKITGGDPTGRFSVPTDPTNNEGLVTVVKPIDYETSRAYVLTVEAKNEVPLTSG
IRYPHMSTATVSISVTDENESPYFEPNPKLIKLEEGMMPESALTIFTAQDPDRFMRQKIT
YSKLSDPANWLRIDPNSGRITTIAILDRESPFVKNNLYNATFMALDDGKPPASGTGTLQI
YLLDINDNAPKVFPQEAEICEKPEPNAINITAVDGDLNPNAGPFAFELAHRPLDVRRNWT
ITRISGDYAQVSLRIGFLESGIYEIPIIITDSGNLPMSNTSYLRVKVCQCDINGDCTDQQ
HIMAAGLGTGAIIAILLCIIILLILVLLFVVWMKRRDKERQAKQLLIDPEDDVRDNILKY
DEEGGGEEDQDYDLSQLQQPDTLEPDAIKPVGIRRLDERPLHPEPQYPMRSAAPHPGDIG
DFINEGLKAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGDQDYDYLNDWGPR
FRKLADMYGGCDD
Download sequence
Identical sequences H3DCN1
ENSTNIP00000018274 99883.ENSTNIP00000018274 ENSTNIP00000018274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]