SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018311 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018311
Domain Number 1 Region: 697-917
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 7.72e-77
Family Fibrinogen C-terminal domain-like 0.00000182
Further Details:      
 
Domain Number 2 Region: 524-691
Classification Level Classification E-value
Superfamily Fibronectin type III 2.18e-19
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 3 Region: 259-430
Classification Level Classification E-value
Superfamily Fibronectin type III 6.74e-19
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 4 Region: 437-529
Classification Level Classification E-value
Superfamily Fibronectin type III 1.38e-17
Family Fibronectin type III 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000018311
Domain Number - Region: 169-192
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000691
Family EGF-type module 0.047
Further Details:      
 
Domain Number - Region: 200-224
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00352
Family EGF-type module 0.069
Further Details:      
 
Domain Number - Region: 231-254
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0067
Family EGF-type module 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018311   Gene: ENSTNIG00000015253   Transcript: ENSTNIT00000018536
Sequence length 935
Comment pep:known_by_projection chromosome:TETRAODON8:15:5986467:6001474:-1 gene:ENSTNIG00000015253 transcript:ENSTNIT00000018536 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGMTHSPLRRVLLLLGLVYAMSLFSAATNDPRASSSERGVTFSHVYKIDVAEGSSCKTEA
PSSEGQTETTPNGENDLVFRHSIKLQTPKCDCDESESFKSLLYRVNGLEEEVTYLKSQCT
QGCCGGGGAAGLDTSCGGHGVYQHETCSCLCNPGWEGPDCSVSSCPDECNDNGRCVDGQC
VCHQGYTGDDCSQVACPGDCSDKGHCVDGRCVCFPHFTGDDCSIQKCPNDCAGHGRCVDG
QCVCDEGLYGEDCSSVFGPQGLRLVRLTDISLLVEWEPVSGAEHYILTYHPKNDEHSLQQ
VQVPHKNSYLISGLTPGVTYIVQVHAVIKEVRSEADTIEATTDISGINDFQVLGQTEVSI
QVGWKNPPAEVDYFRLTATDPSGQEEELSVQRSQEARTKHTILGLFPGTDYQISVQAVKG
AVEGKPSSVTGGTDIDVPGNLVAIDVTEDTVTLSWDRVRADVEGYMLSYTSAEGSSSDIP
VGRYSTSYKLIGLKPGVLYNVYIWAFKEDKVSKKSSTEAETELDAPSDLSAQDVTESSFT
VSRDSTQVHIDGYFLSFSSSAGSSEGIPVGPDSTSYRLTGLKPGVQYTVLIWATKSGDSS
TRVFTEAETDIDAPSELKATDVSVDSSVLTWVPPLADIDGYILTYEHEDGEMKAVEKQLG
HSESRFALSGLETGQRYSVTIIAYRGNKRSKAAQTIFKTVGTLYPFPMDCLQIMKNGNKK
SGIFTVYVNNDRSKPVEAYCDMETDGGGWLVVLQRRTSGKLDFLKRWRQYLAGFGNMTDE
FWIGLDNIYELTNTPTRYELRFDLGLGPDRAYAVYDNFKIASAKQKFKLTIGKYSGTAGD
AMTYHQGQSWTTVDSDNDIALSNCALSHRGAWWYKNCHLANLNGNWGDNRHSMGINWKPW
KGHLLSLDFTEMKIRPVGASSSRKRRSLMVREMSR
Download sequence
Identical sequences H3DCR8
ENSTNIP00000018311 99883.ENSTNIP00000018311 ENSTNIP00000018311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]