SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018313 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018313
Domain Number 1 Region: 1126-1349
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 3.27e-84
Family Fibrinogen C-terminal domain-like 0.00000145
Further Details:      
 
Domain Number 2 Region: 594-761
Classification Level Classification E-value
Superfamily Fibronectin type III 1.73e-22
Family Fibronectin type III 0.0000505
Further Details:      
 
Domain Number 3 Region: 955-1120
Classification Level Classification E-value
Superfamily Fibronectin type III 1.46e-21
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 4 Region: 775-952
Classification Level Classification E-value
Superfamily Fibronectin type III 1.46e-20
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 5 Region: 413-502
Classification Level Classification E-value
Superfamily Fibronectin type III 1.31e-17
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 6 Region: 327-413
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000413
Family Fibronectin type III 0.00078
Further Details:      
 
Domain Number 7 Region: 502-591
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000052
Family Fibronectin type III 0.0000177
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000018313
Domain Number - Region: 240-263
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00301
Family Integrin beta EGF-like domains 0.06
Further Details:      
 
Domain Number - Region: 209-233
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00477
Family Integrin beta EGF-like domains 0.046
Further Details:      
 
Domain Number - Region: 271-295
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0117
Family EGF-type module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018313   Gene: ENSTNIG00000015254   Transcript: ENSTNIT00000018538
Sequence length 1359
Comment pep:known_by_projection chromosome:TETRAODON8:15:5937571:5971782:1 gene:ENSTNIG00000015254 transcript:ENSTNIT00000018538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSADGKSFVVSNLLFGSHIIDFGNRLISPSADNKLVRTTRVRRQTLAGGQAPPLSSENQT
TREQPLVFNHVYNINVPLESLCSVDLDSAASAGPTDDPSGPTEYTEQTLDADSQMTFTHR
INIPKACGCPATATIQQLVTRVEMLEKKVSLLKAQCGSGCCSEGSAMGRVDFVPGCSGHG
SFSFDLCGCICEEGWAGKNCSEPRCPDDCSGQGACVEGECVCDRDFGGENCSEPRCPSDC
SGRGLCIDGECVCEESFTGEDCMVGRCLNDCSDQGTCVNSTCQCRPGYVGEDCSLVYCAN
NCRKGLCKDGFCVCQDGFAGDDCNSVAPVMSLKIRGVTDRSVDLEWDGSVVLTDFLVTYT
PSSAGGVPLEIRIPGNTTACTISDLEAGVEYNINVFAVINNSISVPASITVSTYLSNPDG
LVFKSITETSVEVQWKPFYYSFDGWEISFIPKDNDGGMTAQLPSTITSFVQTGLRPGEEY
TVNLVALRDQGRSQPVTATVTTLIDGPTQLMVRDVSDTVAFVEWTPPKAKLDQIVLRYGL
VGEGPRTTFRLQPTLSQYSLQVLRPGSRYEVSVTGVRTGNESGSISTEFTTEIDAPKNLW
LVSKTSTTLELEWDNSEAEVDGYQVVYSTLAGEQYDKVIVPRNEGATTKTALTDLLPGTE
YGIGISAMKGSNQSTPATMNARTGLDVPMDLTVTASTDNTITLVWGVVQGPIDHYRVTCT
SSSGVTTELTVPKDVTTTTLAGLDPGTEYTITVAARRGRQQSNVATIDAFTGIRPVTHLF
LSEVTSDSVLVAWSAPAPPADLFILSYSSSDGTDTSKVTLDGSKTASLIQGLLPSTPYTI
SLITIQADITSEPITASLTTGMKMHGPHPRKIMVSDVTEDSVTLSWIRPLAPFEYYKLSY
QSARGRVDSMVIDSDVTNYTLSSLFPATEYEISLSAVKESQESSVVSTSVFTAMDMPSEL
TALNITPRGALLRWNPPLSVVDNYVLTLTHNQVTADTFLVEGTKQEHQLSSLSPSTSYSV
ALYATKGPLTSGTVITNLQTPMDAPLNLTASEVNHRSALISWQPPMAEIDNYMLTYKSVD
GGRKELILDAEDTWIRLEGLAEITEYTVKLQAARGLDTSAIVSTTFITGSRLFAMPQNCA
QHLLNGETLSGVYTIYINRDPSQGVQVYCDMTTDDGGWIVFQRRQNGLTDFSRKWSDYRV
GFGNLEDEFWLGLDNIQRVAAQGRYELRIDMKDGQESVYANYDKFSIGDARDLYKLRIGE
YNGTAGDSLSYHQGRPFSTKDRDNDIAVTNCALSYKGAWWYKNCHRANLNGKYGESRHSQ
GINWYHWKGHEFSIPFVEMKMRPFNYRSISSKRRRSAPV
Download sequence
Identical sequences H3DCS0
ENSTNIP00000018313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]