SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018368 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018368
Domain Number 1 Region: 982-1134
Classification Level Classification E-value
Superfamily C-type lectin-like 5.25e-43
Family C-type lectin domain 0.00000569
Further Details:      
 
Domain Number 2 Region: 123-233
Classification Level Classification E-value
Superfamily C-type lectin-like 1.75e-34
Family Link domain 0.0052
Further Details:      
 
Domain Number 3 Region: 234-320
Classification Level Classification E-value
Superfamily C-type lectin-like 1.48e-26
Family Link domain 0.002
Further Details:      
 
Domain Number 4 Region: 1135-1193
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000681
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 5 Region: 9-124
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000225
Family V set domains (antibody variable domain-like) 0.019
Further Details:      
 
Domain Number 6 Region: 929-969
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000328
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018368   Gene: ENSTNIG00000015305   Transcript: ENSTNIT00000018593
Sequence length 1227
Comment pep:known_by_projection chromosome:TETRAODON8:15:4976462:4987962:1 gene:ENSTNIG00000015305 transcript:ENSTNIT00000018593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNMRRITHPPVQQVLAGRATLPCVFTLQTNSSERPPFLLWTHTGIPAGGKGAPQEQVVLS
AKGDVIKVNKAFSGRVMLPGYAANPLNATMEISSLRSNDSGTYHCQIVMDNDYERDTVPL
VVSGVVFHYQPPGARYALSFTDAQRACREVSAHMAAPAQLWAAYYDGFASCAAGWLDDQT
VRYSVQSPELGCYGHKEYLAGVRNYGKKDPKELFDVYCFAQELDGEVFHSSVPGRLSLSS
ASDRCVSLGGQLATVGQLYLAWKAGLDSCAPGWLADGSVRYPVTWPRPDCGGSWPGVRTV
PPNTTDDNTTAVYDAYCYRGRVETSEPLSQIYSSLWKPWSYLTGSSVTAQTSPIKGFYFN
LHMADLWKHQLAGFYDKNFHLSFFSVNTSSTEGSGDVLPSNWTGLVDLEEETPPSADACK
PDFQIKDLTVTPASDPWSSESSGSFVTLQLIPGQSWFDWGESLDPGLDSEEFLRPLVNPT
PAEKKFLLQTCVTETKWTIMKIVSSISKPWNYLLGTEDEPEVPDEAPTSKSGGEKGPTTT
KTADESNSSTSADDGQTCLWWTPSKAGLSNCSTSAAAGFCSNKQQHRLSLCQTGPMPWLN
SCPVLCFVIAAGLFSWGSSWFSAPTSENPTPPGKDTPAHPVSTSNPKMAESNKSLENSEW
HTFTPSGSAAAATSQMSRRPVGTSKPRERSRERSRERGHRRGQTTTTRAAAPTTNPLELT
VMSTTVSESRGVSVSGSTSALPTESPSVSVDPSSVPTPSFLVTTSLSPSSLPPSKSLLEA
RSPSPSEAIPFSFSASPATSSSSHHSPNSFLSSSPAPLFPDSSSQTVGSEDPSLSPITDN
QDSSTKPHTSLTWVPVETAVLNSSLDYPPLLPGAPDEEEPAWSHAVGSGALLPGNMEEEG
SRGGANTSTASSLSPTDIGLQRPAGSHPVEVDPCVTNLCLHGGKCLPQGTGYSCYCPQGY
AGENCEIDVDDCQSDPCENGGTCIDKTDSYVCLCLPSYEGDRCEKDIEGCERGWRKFHGH
CYKYFTHRHTWEDAEKDCREHSAHLSSILSAAEQEFINGLGHDNAWIGLNDRTVEEDFQW
TDNTDLVYENWRENQPDNFFAGGEDCAVTIAHEEGKWNDVPCNYNLPYICKKGTVLCGTP
PAVENAHLIGRRRSHYDIHTVVRYQCSEGLFQRHIPTIRCRADGSWERPRIICAKSRRSH
RYRRHRHTLHREHRGHRRHRDGHKARE
Download sequence
Identical sequences H3DCX5
ENSTNIP00000018368 99883.ENSTNIP00000018368 ENSTNIP00000018368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]