SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018397 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018397
Domain Number 1 Region: 1-444
Classification Level Classification E-value
Superfamily Sema domain 1.83e-142
Family Sema domain 0.00000000422
Further Details:      
 
Domain Number 2 Region: 448-498
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000719
Family Plexin repeat 0.0016
Further Details:      
 
Domain Number 3 Region: 511-573
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000279
Family I set domains 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018397   Gene: ENSTNIG00000015333   Transcript: ENSTNIT00000018622
Sequence length 673
Comment pep:known_by_projection chromosome:TETRAODON8:15:4683452:4687421:1 gene:ENSTNIG00000015333 transcript:ENSTNIT00000018622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLREDLDTLLVGAREAIYALDLKDISKKRASVKWEVTQQQISDCQNKGKDPEMDCKNFI
RILHKMDDNNKMYVCGTNAFDPQCDYMSYTEGQLTLERKVEDWQRKVSRHTSLMAGNDLY
SATSMNFLGSEPILLRNPPVPVRTEFKNSWLNEPTFVSMTQIPESHMSALGDDDKVYLFF
SETAVECDCYQKLVVSRVARVCKGDMGGQRTLQKRWTSFMKARVECPVPGARLPYVIQDA
YRWCGSPWLWSDCLFFAVFKPQSTFTSDLSAVCAYRVSDISRVFAEGKYKTPVTVETAFV
KWVTYSGDVPVPRPGACIDNEARKIGIKDSLQLPDPTLQFIKMRPLMDQTVQPVGGKPLL
VRKGASFTCIVVDQVQAADGEQHHVMFIGTEEGTLVKAVNYDGEMFIIEEVQVFQHREAI
KILKISNVTGQLYAGSDSGATQVPRATCGRSSSCMDCVLSRDPYCGWDAVDGKCSLLSSS
NRTGELIQSVREGDAKRCPPAGELAPLIPLKRTIWPGGNLNLSCSSPSQLAETVWELDGK
TLTPTARVQSLRDGLLIFHASGSDAGRYRCLSVEKSKAGLFTTTVAEYQVGLSGGNPGLE
IAIGLLIACLFSLTLWNCYKGHISLPWNCRRTKEQTEEHGRPTRHCGCKTVHFRQPASDV
NTHNLDTPDSTEI
Download sequence
Identical sequences H3DD04
ENSTNIP00000018397 99883.ENSTNIP00000018397 ENSTNIP00000018397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]