SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018398 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018398
Domain Number 1 Region: 30-502
Classification Level Classification E-value
Superfamily Sema domain 1.07e-156
Family Sema domain 0.00000000173
Further Details:      
 
Domain Number 2 Region: 506-557
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000123
Family Plexin repeat 0.0013
Further Details:      
 
Domain Number 3 Region: 571-633
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000432
Family I set domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018398   Gene: ENSTNIG00000015334   Transcript: ENSTNIT00000018623
Sequence length 705
Comment pep:known_by_projection chromosome:TETRAODON8:15:4671268:4674659:1 gene:ENSTNIG00000015334 transcript:ENSTNIT00000018623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDQMHLLLFLFWLLPLACTLKDASSLECTPRRFVAFHEDNANLFREEGVANYTTMLLRED
LDTLLVGAREAIYALDLKDISKKRASVKWEVTQQQISDCQNKGKDPEMDCKNFIRILHKM
DDNNKMYVCGTNAFDPQCDYMSYTEGQLTLERKVEDGKGKCPFDPFQRHTSLMAGNDLYS
ATSMNFLGSEPILLRSSHVPLRTEFKNSWLNEPTFVSMTQIPESHMSALGDDDKVYLFFS
ETAVECDCYQKLVVSRVARVCKGDMGGQRTLQKRWTSFMKARVECPVPGARLPYVIQDAY
RWCGSPWLWSDCLFFAVFKPQEETSDLSAVCAYRVSDISRVFAEGKYKTPVTVETAFVKW
VTYSGDVPVPRPGACIDNEARKIGIKDSLQLPDPTLQFIKMRPLMDQTVQPVGGKPLLVR
KGASFTCIVVDQVQAADGEQHHVMFIGTEEGTLVKAVNYDGEMFIIEEVQVFQHREAIKI
LKISNVTGQLYAGSDSGATQVPRATCGRSSSCMDCVLSRDPYCGWDAVDGKCSLLSSSNS
FRTGELIQSVREGDAKRCPPAGELAPLDPLERTIWPGGNLNLSCSLPSQLAKTVWELDGK
TLTPTARVQSLRDGLLIFHASGSDAGRYRCLSVEKSKAGLFTTTVAEYQVGLSGDGILPH
AQIRGPSVAGLQAAVGLLVVCLLGLLTWSCYKGHIPLPWNCRRTR
Download sequence
Identical sequences H3DD05
ENSTNIP00000018398 ENSTNIP00000018398 99883.ENSTNIP00000018398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]