SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018402 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018402
Domain Number 1 Region: 60-520
Classification Level Classification E-value
Superfamily Sema domain 7.72e-145
Family Sema domain 0.000000185
Further Details:      
 
Domain Number 2 Region: 516-564
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000419
Family Plexin repeat 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018402   Gene: ENSTNIG00000015338   Transcript: ENSTNIT00000018627
Sequence length 790
Comment pep:known_by_projection chromosome:TETRAODON8:15:4630379:4638328:1 gene:ENSTNIG00000015338 transcript:ENSTNIT00000018627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCAAAMGTVAPPLTFLLLLLHLAEGSFPEEPSPLSYVPIEVVRRYPIFLGRAHRSSLRQE
LHIQTVLQVNRTLYIGSRDDLYRVELDNMAGDEMFYSKKRTWESNKNDIRVCRMKGKHEG
ECRNYIKVLLSQHGGLFVCGTNAFNPLCANYTKDTLEMVGEPVSGMARCPYDPRHANVAL
FSDGSLFTATVTDFLAIDAVIYRSLGDSPALRTVKHDSKWFREPYFVSSMEWGPHIYFFF
REMAMEFHHLEKVMVSRVARVCKADLGGSQRVLEKQWTTFLKARLNCSVPGDSHFYFNLL
HATSDIIHMQGRDVILGLFSTPPNSIPGSAVCVFDMQQLARVFEGRFKEQKSPESIWTPV
PDEAVPKPRPGGCAVQGSRFSSSTTLPDEVLNFVKTHPLMDETVPLLGHRPWVVKTMGRY
QLTAMVVDTEAGPHKNRTVLFLGSTRGTILKFLMIPSGDSVSHSSVFLEEVEGFNPEKCG
EDSPQARQLLSLTLDRTSHTLLLAFPACLIRMPTSRCHLYSRCMKSCLASRDPYCGWTRG
STCSFLRPGTRLPFQQDVDFGNTTSHLGDCDGILQQSLLIEPESLVSLNLLVASAVSAFT
IGAALSGLAVCWIMAHKPTNRRSAGQSSVQRRERGLLSHGGGIGGSVLSVTRQGGGERPC
SQGGETLFVMPNGWVKSGELDPGFLPTPEHTPQQKRRGLRLSDSNSGGWDTSQTYLGGGS
VGLGSPCRMPPSVYLTTRLFQQGGGRKSAGEYVYPMTPQDSPERRRVVSAPSAPVEYSEP
LPLRWPAPEG
Download sequence
Identical sequences H3DD09
99883.ENSTNIP00000018402 ENSTNIP00000018402 ENSTNIP00000018402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]