SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018413 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018413
Domain Number 1 Region: 68-231
Classification Level Classification E-value
Superfamily RUN domain-like 4.18e-52
Family RUN domain 0.000000051
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000018413
Domain Number - Region: 265-454
Classification Level Classification E-value
Superfamily Tropomyosin 0.0105
Family Tropomyosin 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018413   Gene: ENSTNIG00000015349   Transcript: ENSTNIT00000018639
Sequence length 469
Comment pep:known_by_projection chromosome:TETRAODON8:12:3745417:3749133:-1 gene:ENSTNIG00000015349 transcript:ENSTNIT00000018639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDLTPQGETPTPTTDKITQAARETIYLCNFRVSVDGEWLCLRELNDISLTPDPEPAHED
PKDPIAIERLNLMNMAKLSIKGLIESALNLGRTLDSDYAPLQQFFVVMEHCLKHGLKTKK
TFLGQNKSFWGALELVEKLTPEAGEITASVKDLPGLKTPLGRGRAWLRLALMQKKLSDYM
KTIINRKDLLSEFYEPNALMMEEEGAVIAGLLVGLNVIDANLCMKGEDLDSQVGVIDFSM
YLKDGGHSSKSAEGDGQITAILDQKNYVEELNRHLSASVNNLQAKVDALEKSNTKLTEEL
AVANNRIITLQEDVERVKEESSYQLESRKAVRSDSASDGQALGETRKQLKEETLLRLDVE
KELEVQIGMKQEMEMSMKMLEKDICEKQDALVELRQQLEDLRAINQQLLHKSQTSDASSK
QKNEAISRLEEKINQMSGTVKQMEASEKHLVKQARNLNSAAGKLLQFQQ
Download sequence
Identical sequences H3DD20
99883.ENSTNIP00000018413 ENSTNIP00000018413 ENSTNIP00000018413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]