SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018426 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018426
Domain Number 1 Region: 1460-1544
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000042
Family SH3-domain 0.0022
Further Details:      
 
Domain Number 2 Region: 1019-1197
Classification Level Classification E-value
Superfamily RUN domain-like 0.000000353
Family RUN domain 0.03
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000018426
Domain Number - Region: 175-239
Classification Level Classification E-value
Superfamily Avirulence protein AvrPto 0.0772
Family Avirulence protein AvrPto 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018426   Gene: ENSTNIG00000015362   Transcript: ENSTNIT00000018652
Sequence length 1555
Comment pep:known_by_projection chromosome:TETRAODON8:12:3556162:3565284:-1 gene:ENSTNIG00000015362 transcript:ENSTNIT00000018652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPALFWTMASPRKLSGETLIVHHIPLVHCQVSGGRRAQPRASLKRSNPFSLPENLGLSRT
TSLPERDVLQREALLYSSLIQTSGGVWAPFSTHKEKKSGSGRGGSTTIRHNPFLLNHDDD
DDGNEEEDADGDNLSGYLEDSSFHLHSDTNSALDEGVSSFHLHDLRFTPEPFLLHNLAGG
SSQESLRGLSSDLSNHFEDLEDIVEMDVQRRHGSSGSNMSMDCAEHDWGDYEEDEDHSMR
CGRSSKMDSYSSSSSTQHCSCCALSQSYQCQQDYASDSSCNSSDGVLVNFSAIYSKMNNG
VPEKTPLSGHANLNHSTDHSCTSSTSDLPGNQQHSTKGAFYLDLHTSPTDPPTLQRHPTF
PVINEPRLSSSSTCSCAAEHQGALDLDANCNSYHPLHSESSGDLASCLQSQARLVVATQN
YYKLVTCDLSSQSSPSPAGSSVNSCSDEHSKSSPTPTQPTEYFLFKQPADEEDEESGSRP
SIRVAAGTEAAPAVMRGQVYVNVSPPTVGRCAVGEGSSSGCRPRSRSYDRNLGKTPSPRL
GSLERMLSCPVRLSEGAAQAPPPPPRVTSFAEIARSKRRNGGVLPSPSLKAAADPFSSTF
STQSHSSADFSPILEHHVEVEGHSLPAVGLQRQTDVETHTPLSSEWLEFQWIRTRDSKNC
LHWSGQSQRAPAASLTSPNPAENPRTHMPFNNERGKAGGGKGTLLVRYRKDQRPTTLPIQ
PFTFHHQFATKPPQPKPPVPLSTGQASGMQAQSSPGSSLDTRAPTEEDNEDATENMHRSA
PPPGSVRPSPLGSYSPVQLQGGTGSSTCSTCTSSPQPPHTLSCQLQSPGTADTPPPPSLG
VKRGMVPPVLPAVRGHCLHHGTLSALSAGDSDVLSPLGCLDPGTHTGSSGQGGRSHHAHH
LSPQALKWREYRRRNPSGPGGHGSNLEHRSGGLPRQPRRNVFDFPPAPLGQGLGHFNGAY
QQSVGTDVLQQSLRDFQPDYFSLSEKPPEEFCLSPNVSTSASSGCSPKSHISVDLTQKRG
LVKAVNTAVDLIVAHFGTSRDPDVKAKLGNSWVSPNVGHLILKYLCPALHEVLQDGLKPY
VLDLIIGQRRCQPWSLAEASTQLGPSTRVLHSLFSKVSQYSELTNHSLRLNSFIFGLLNL
KSLEFWFSHLYTHDDIIAAHYNPWGFLPLSQGVCQPLFEELLLLLQPLSLLPFDLDLLFE
PHLLQNCQEQLRRKEQLCSAGQSADRSARSTFQLIEALVEVGISNLWRERGMTGQRMKGV
GQERLEGGKDGQKTEADEARGGRQRQERNAGWWYQLMQSSQVYIDQSTEGAKFVRNEKRK
KSLERRQAQLPPTREGVVEGAESVRKEEGYRSSRSSTEPAGSRARLSWMGSPPESIIHQE
KEAKPLKVSGMEDHARAPEQSPSKGQSLRWGRLFGAVGGSHSRVDGAEDKTKCPSARPPS
GWLSLDRSVLDFVAQTIGVGKKTESPDTPTCTQTTHPTAPTPAAEAKRREVQALCHHIAT
EPGQLSFSKGDVMEVVSRVHPDWLLCSLGSAKGLVPIVYVTLNSTEESQDSAGHG
Download sequence
Identical sequences H3DD33
99883.ENSTNIP00000018426 ENSTNIP00000018426 ENSTNIP00000018426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]