SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018429 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018429
Domain Number 1 Region: 2700-2988
Classification Level Classification E-value
Superfamily BEACH domain 3.66e-115
Family BEACH domain 0.0000000323
Further Details:      
 
Domain Number 2 Region: 3056-3256,3436-3468
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.2e-33
Family WD40-repeat 0.0012
Further Details:      
 
Domain Number 3 Region: 2546-2668
Classification Level Classification E-value
Superfamily PH domain-like 2.64e-22
Family PreBEACH PH-like domain 0.015
Further Details:      
 
Domain Number 4 Region: 3476-3544
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 5.76e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0013
Further Details:      
 
Domain Number 5 Region: 1105-1244
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000109
Family Trypanosoma sialidase, C-terminal domain 0.064
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000018429
Domain Number - Region: 377-434,471-515,544-602
Classification Level Classification E-value
Superfamily ARM repeat 0.000276
Family Clathrin adaptor core protein 0.084
Further Details:      
 
Domain Number - Region: 1421-1473,1525-1586,1620-1716
Classification Level Classification E-value
Superfamily ARM repeat 0.000911
Family HspBP1 domain 0.047
Further Details:      
 
Domain Number - Region: 117-344
Classification Level Classification E-value
Superfamily ARM repeat 0.00115
Family MIF4G domain-like 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018429   Gene: ENSTNIG00000015365   Transcript: ENSTNIT00000018655
Sequence length 3550
Comment pep:known_by_projection chromosome:TETRAODON8:12:3501098:3536855:-1 gene:ENSTNIG00000015365 transcript:ENSTNIT00000018655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMVKRIMGRPRQEECSPQDNALGLMHLRRLFSELCHPPRHMTQKEQEEKLYMMLPVFNR
VFGNAPPSTMTEKFSDLLQFTTQVSRLMVTEIRRRASNKSTEAASRAIVQFLEVNQSEET
SRGWMLLTTINLLASSGQKTVDCMTTMSVPSTLVKCLYLFFDLPHMTEAPGHPPQELAPA
DRRALLQKVFVQILVKLCTFVSPAEELAQKDDLQLLFSAITSWCPPHNLPWRRSAGEVLT
TISRHGLSVNVVKYIHEKECLATCVQNMQQSDDLSPLEIVDMFAGLSCFLKDSSDVSQTL
LDDFRMCQGYAFLCDLMLRLEQAKEDESKDALKDLVNLVTCLTTYGVTELKPAGLTTGPF
LLPGFVLPQPSGKGHTVRNIQAFSVLQNAFLRAKTSRLACMLLDAIGNIYAADSANYFIL
ESQHTLSQFAERVAKLPEAQAKYFELLEFVVFSLNYVPCKELFSVSVLLKSSTSHACSIT
AVRTLLKLARHDPVFSDVLREVGLLEVLVNLLHKYAALLKDPAQQHPHNNDQADCKNNTA
AEEQKQLALLVMETLTVLLQGFNNTNAALFREFGGARCVHNIVKYRQCREHALLIIQQLV
LSPSGDDDMGTLLGLMHSAPSTELQLKTDVLRGQLFKVLRESHRTRTVFRKVGGFVYVTS
LLVAMERSLCQPPRHGWDRVNQNQVFELLHTVICTLTAAMRYEPANSHFFRTEIQYEKLA
DAVRLLGCFSDTKKLGPTSVFPSNAQPFQRLLEDEATTGGCAGDSVCPTLKHCSKLFIYL
YKMATDSFDSRAEQVPPCLTHETSLPSPWGTPALARKRHGYYGTTGSTAPVKALSDLKLH
VANTSHPISSSSLADTVVIHPGAVLAMLDLLPSVSSDSQPEHALDLQLAVANIQLLVNSD
RNQQVLCEACLHQRLARCSHALGDEDHPLHPPLQRMFERLASQALQPMALREFLRLGNPL
NCGAWDKKLLKQYRVHKPSSLGYDAEMRNSMTLSMEGFGPDSVFAAPAEDNGQYRISRSL
VRSPEGSTVPLTRVKCLVSMTTPHDIRLNGSAVTPAFVEFDNSLEGFGCLFLPSLAPHNA
PTNNTNASGVSDGAVLSGMGAGERLFPPPSGLSYSTWFCVERFSSAPQAHPVRLLTIVRR
ATTSEQHYVCLAVVLSAKDRSLTVSTKEELLQTYSDESSEEASFYEILPCCARFRCGEAI
AEGQWHHLVLVMSKGMLKNSMATLYIDGQLINTVKLHYIHSAPGGSGSTNPPVVSTVYGY
VGTPPAQRQISSLVWRLGPSYFLEEVLPATSVAAINELGPNYVGSFQAVYLPCKDSKAEV
SPASPVALVPEEKVSFSLCALSVSTLTVAKIRKVYNKLDSKAIAKQLAVSSHENATPVKL
IHNAAGHLNGPARTIGAAVIGYLGVRAFVTKPVATNLQYVGGAAAILGLVAMASDVEGLY
AAVKALVCVVKSNPLASKEMERIKGYQLLAMLLKKKRSLLNSHILHLTFSLVGTVDSGHE
TAIIPNSTAFQDLLCDFEVWLHAPYELHLSLFEHFTELLTESSEAAKNAKLLREFQLIPR
LLLTLRDTSLSQPTIEVTLTALFSTNERIIASHRLDSFGQFISSTLPTFAVCEKFVVMEI
NNEEKIDGGNDDDFGGLLSANLILLRNRLLDNLLRLLFTTKEKCSINAQACEELVRTLGF
DWLLMFMEEHLHSSTATAALWILVVLLSNQSILNRFREGLCGGGWLDHTDSVLTNKIGTV
LGFNVGRSAGGRSTVREINREACHFPGFPVLQTLLPKHTNVPELYFLLMALFLQQPVTEL
PDSLHIHVSIFTLFFRSFVLFFDLDSIWTFIFGMPASSATVGSIHNVCTEAAFLLLAMLR
SMLNLPWQSEEEGSWLREYPVTLMQFFRYLYHNVNDLSPMWHSPEFLCALAAAVFPFNIR
PYSEMVSDLDDEAGSPIEEFKAFAGDSCMNRSQSEYCNVGSKTSLTNHPAKKYVFDFMRV
LIMDNLCMTPASKQTPIVDLLLEASPERSTRTQQKEFQSNILDGVMEHLLAADVLLGEDA
SLPLSSGGSYQILVNNVFYFTQRVVDKLWQGMFNKDSKLVVDFIVQLIGQSKRRSQGLSL
DTIYHCLNRTVLYQLCRPHKTVAQQVALLDALRVLTVNRNLVLGPGNHDQDFVACLAHCF
ICLHSGSSVEGFGLEAEARMTTWHVMMPTENEADATHSHDVSEGRQLLLKAVNRVWTELM
HSKRQMLEDIFKVSLPCNDRGHVDIATAKPALEEPALKSWQNHLVYEKKCVSRGEALAPA
TQSKLSRVSSGFGLSKLTGVRRNKKENSLNKNSLSAQETFQWMFTHIAVVRDLVAMQYKE
YQERQQNSLKYVTEEWASNEYELLRERGLWGPPIGSHLDKFMLEMTEGPCRMRKKMVRND
MFYIHYPYIPEIEPNTSTAQSSYVLQPSSPPLVPLQKPLRYRRAISYDSKEYYMRLLSGN
PGMYQHSVEHSTEGETTHHEPEHGEDTIARVKGLVKAPLKRSRSTADGADEDNQDQLQEQ
LLESGGPEEEQRTDNTSLLRLLEEGEKIQHMYRCARVQGLDTSEGLLLFGKEHFYVIDGY
TMTVSREIRDIDTLPPNLHEAIIPRGARQGQSQLKRTCSIFAYEDIKEVHKRRYLLQPIA
VEVFSADGRNYLLAFQKGVRNKVYQRFLAVVPSLADSSESVSGQRPNTSVEQGSGLLSTL
VGEKSVTQRWERGEISNFQYLMHLNTLAGRSYNDLMQYPVFPWILADYDSEELDLNNPKT
FRNLAKPMGAQTDDRLAQYKKRYKDWEDPNGETPAYHYGTHYSSAMIVASHRFSSDFRSN
PHFSIYGGHFDLADRMFHSVREAWFSASKHNMADVKELIPEFFYLPEFLLNSNNFDLGAK
QNGTKLADVILPPWAKGDPREFIRVHREALECDYVSAHLHEWIDLIFGYKQQGPPAVEAV
NVFHHLFYEGQVDIYNINDPLKETATIGFINNFGQIPKQLFKKPHPPKRVRSKTNGDVTS
VPPSSNSDKIFFHHLDNLRPSLAPVKELKEPVGQIVCTDKGILAVEQNKVLVPPTWSKIF
AWGYADLSCRLANYDSDKALVVYECLSEWGQIVCAICPNPKLVITGGTSTAICVWETGPS
KERAKSLMLKQALLGHTDAVTCLTASSAYRIVVSGSRDRTCIIWDLNKLSFVTQLRGHRA
PVSALCINELTGDIVSCAGTYIHVWSINGSPISSANTFTGRSQQILCCCVSEMNEWDTQN
VIVTGHSDGVVRFWRMEFLQVPETPAPQPVEPEVPDCCGEEKIEGGETHNGDDDSSDSDG
DEPSLNQEPKAPRNPSTGGGSQPGSTVHRPRGPSTRAGASWSMDSSSDDSHRWSDTLSVD
EKDGFVFVNYSEGQAKVPHPHPSNPGQSSVSQPFQPSNTDARHYNQLRTGYRWERQLVFR
SKLTMHTAFDRKDNAHPAEITSLAISKDHSKILVGDGRGRVFSWSVSDQPGRSAADHWVK
DEVVDNCSGCTVRFSLTERRHHCRNCGQLFCQKCSRFQSEIKRLKISSPVRVCQNCYYNL
QHELSAEGRN
Download sequence
Identical sequences H3DD36
ENSTNIP00000016033 99883.ENSTNIP00000018429 ENSTNIP00000018429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]