SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018457 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018457
Domain Number 1 Region: 1670-1753,1780-2037
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.48e-80
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.0000514
Further Details:      
 
Domain Number 2 Region: 1475-1657
Classification Level Classification E-value
Superfamily ARM repeat 7.2e-39
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.014
Further Details:      
 
Domain Number 3 Region: 16-46,85-166,312-373,511-737,875-962
Classification Level Classification E-value
Superfamily ARM repeat 0.00000576
Family MIF4G domain-like 0.091
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000018457
Domain Number - Region: 788-874
Classification Level Classification E-value
Superfamily ADP-ribosylation 0.00176
Family ADP-ribosylating toxins 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018457   Gene: ENSTNIG00000013531   Transcript: ENSTNIT00000018683
Sequence length 2042
Comment pep:known_by_projection chromosome:TETRAODON8:4:4017770:4030153:-1 gene:ENSTNIG00000013531 transcript:ENSTNIT00000018683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCPVDFRGVYQLDERRRDAVIALGIFLVESDLQHKDVIVPYLLGLLKGLPKVQWIEESSE
HKGREKLPVAENFTFSLVTLLSDVAQRDETLRGKILETIMDIMQVLQMICKNPEAQDKEY
LCRYIVPTLLGVARAFGRYSNTDEPLLSKLFPRPLAPVLPSADDTEAAQRSFNDFRSILP
SPLLTVCQGDTLRRKGPSLSSPSQQASPERACLTPSSPADPSAQYFEGSYLPDGSADPDY
YFSTISSSFSVSPLFTGSSSGEFHVPLDMLRQLLHMVEQFVSEQFLKSLDDGLGEVLELN
PGLHLHYKTFSDPLYVAIFKMLRDTLYNLKDLQTDYVKEVHDFVLEQFSSSQSELQRILH
DVEYLQSELSPLKLRCQANAACVDIMVWAVTEEQGAENLCTKLSEKLQSKTSSKVIIAHM
PLLICCLQQGLGRLCERFPVVAHSVTMSLRDFLVVPSPVLVKLYKYHSQYTPGGSEIKIH
VTNEHSQSTLSAHSSKKSQPSMYEQLRDIAIDNICRCLKAGLTMDNVIVEAFLASLSNRL
YIYQENDKDAHLIPDHTIRALGHIAVALRDTPRVMEPILQILQQKFCQPPSQLDVLIIDQ
LGCMVITGNQYIYQEVWNLFQQISVKASSMVYSTKDYKDHGYRHCSLAVINALGNIAANL
QAEQMVDELLVNLLELFVQLGLEGKRASERASDKGPALKASSSAGNLGVLIPVIAVLTKR
LPPIKEAKPRLQKLFRDFWLYSVVMGFAVEGSGLWPAEWYEGVCEIATKSPLLTFPSGEP
LRSELQYNSALKNDTVTAAELNDLRSTIINLLDPPPEVAALVNKLDFAMSTYLLSVYRLE
YMRMLYSLDSDRFQVMFRYFEDRAIQKDKSGMMQCVVAVSDKVFEVFLQMMVDKPKTKAH
EEELERHAQFLLVNFNHIHKRIRRVADKYLSGLAETFPHLLWSGRVLRTMLDILQTLSLS
LSADIHKDQPYYDIPDTPHRITVPDTYEARESIVKDFAARCGEILKEAMKWAPSVTKSHL
QEYLNKHQNWVSGLSQHTGLAMATESILHFAGYNRQSTTLGSTQLTERPACVKKDYSNFM
ASLNLRNRYAGEVSGMIHFAQAVRGLSDLSQLMIKQMGEALDSGQPEAFTEAMFKLAALL
ISSKECDPQLLHHLCWSPLKMFTAHGMETAIACWEWLLAARVGVEVAFMREMAGAWQMTV
ELKKGLFSDTQVEADPLAASEESQPIPCPPDITPHHIWLEFLVQRFEIAKYSSADQVEIF
GTLLQRSLSLNVGGVNSSLNRHVAAIGPRFRLLTLGLALLHSDVLTNATVRNVLREKIYS
TAFDYFSGAPKFPTQGDKNLREDISIMIRFYASILSDKKYLAACHLVPPVMNAADLRSNM
DSSSRSQQGGQGWINTYPLSSGVSTASKKSGTSKKSNRGTQLHKYYMKRRTLLLALLASE
IERLMTWYNPLSTQELAISMEQSVETSIANWRSKYISLTEKQWKDNVNLAWDISPYLAIQ
LPTRFKNDAIVAEVTRLVRMDPGAVSDVPEAVKFLVTWHTIDADSPELSHILCWAPADPP
TGLSYFSSMYPPHPLTAQYGVKVLRSFPPDAILFYIPQIVQALRYDKMGYVREYILWAAQ
TSQLLAHQFIWNMKTNIFVDEEGHHKDPDIGDLLEQMVEEITSSLSGPAKDFYQREFDFF
NKITNVSAIIKPVPKGEERKRACLKALSDIKVQQGCYLPSNPEAVVLDIDYKSRTPMQSA
AKAPYLAKFKVKRCGVSELEREGLRCASDSTDEQNSDGSSRVCWQAAIFKVGDDCRQDML
ALQIIGLFKNIFQLVGLDLFVFPYRVVATAPGCGVIECIPDCKSRDQLGRQTDFGMYDYF
RNQYGDESTLAFQKARYNFIRSMAAYSLLLFLLQIKDRHNGNIMLDSKGHLIHIDFGFMF
ESSPGGNLGWEPDIKLTDEMVMIMGGKMEATPFKWFMEMCVRGYLAVRPYMDAVVSLVTL
MLDTGLPCFRGQTIKLLKGRFNPQMSEKEAAAFIIKVIQSCFLSSRSKTYDMLQYYQNQI
PY
Download sequence
Identical sequences H3DD64
ENSTNIP00000018457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]