SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018504 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018504
Domain Number 1 Region: 110-214
Classification Level Classification E-value
Superfamily C-type lectin-like 1.42e-35
Family Link domain 0.0039
Further Details:      
 
Domain Number 2 Region: 220-303
Classification Level Classification E-value
Superfamily C-type lectin-like 2.36e-23
Family Link domain 0.002
Further Details:      
 
Domain Number 3 Region: 2-109
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000438
Family V set domains (antibody variable domain-like) 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018504   Gene: ENSTNIG00000015435   Transcript: ENSTNIT00000018730
Sequence length 305
Comment pep:known_by_projection chromosome:TETRAODON8:12:2567576:2569090:1 gene:ENSTNIG00000015435 transcript:ENSTNIT00000018730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KVLANLGGNATLPCRLPSKDTMFFGAAGIRVKWTKVADDEAFNQDVVLSMGFHKRTFGSF
EDRVYMVSNDNEDGSILITNIAMQDAGKYHCELINGMTDVTQEVYLEVQSVVFPYHLRLG
RYHLNFTKAVLACQEQDAKVASYDQLLDAWRGGLDWCNAGWLSDGSVRYPITKPREPCGG
ANITPGLRSYGWQNRRSLFDVFCFASRLKGTFYWLVQPERLTFAEAVQACLDDGAEIAKV
GHIFAAWKLEGYDRCDAGWLADGSVRYPISRPRKNCSPTEAAVRFVGFPDKKQRSYGVYC
YKAQQ
Download sequence
Identical sequences H3DDB1
99883.ENSTNIP00000018504 ENSTNIP00000018504 ENSTNIP00000018504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]