SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018520 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018520
Domain Number 1 Region: 783-1079
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.37e-85
Family Complement components 0.0000119
Further Details:      
 
Domain Number 2 Region: 1173-1284
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 6.93e-32
Family Alpha-macroglobulin receptor domain 0.001
Further Details:      
 
Domain Number 3 Region: 622-673
Classification Level Classification E-value
Superfamily E set domains 0.00000000294
Family SVA-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018520   Gene: ENSTNIG00000015449   Transcript: ENSTNIT00000018746
Sequence length 1284
Comment pep:known_by_projection chromosome:TETRAODON8:1:14903782:14924619:1 gene:ENSTNIG00000015449 transcript:ENSTNIT00000018746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TEGGYIFHNYTTVTVESKGTAVFIQTDKPIYKPQHRVLINVYTVTPDLRPVNDKIEAYVL
DPRGSRMVQWKGLKPICCGVVNMSFPLSDQPVFGEWFVFVEVQGYTYNRSFEVQKYVMPK
FELVIEPPPYIRDLNSCQQASVRARYTFGKPVVGKLTVNMTVNGVGYYRQETGHPVIKTM
EIKGSANFSLCVKDMMPPDVARPFRGSVSIWASVTSVDGSRQTTFDDSTPVHKQLIDIKY
SKDTRKQFKPGLPYKGKIEVTYPDGSPANGVKVRVKAELTTKDNVYTSELISKDGEATFE
IPSIPTAAQYVWLETKVMSIDGKAVGDQYLPSYLSISSWYSPSRCHIQIQSPNIPLKVGQ
KAKVALKSTCPCNFTLHYEVTSRGNIVLSGQQPSNPTASHRDHSMAPLSHLLVYYVRENG
EGVTDSVQIPVQPAFENQVSVSLSANETMPGDPVTLRVHGEKGSCVCVATVDKSLYLLKP
DFQLSSDKTQTLLRLYPTSHHIYYLPSQICLTQETGLIVMTDMVSLNHRQSGGMYTDEAV
PAFQPHTSTLVAAVHSRPTARTEKRRRTFFPETWVWHCLNVSSETGQAELRLDVPDSITT
WVTEAVGLSEEKGLGLARRAELRTFKPFFVDFTLPYSLIRGEQTKVPLTVYNYLPTCAEV
HVKVSVPKGIKFVGHPGKHHLTRKKCVPPGEATPTSIVFSVTELGPANITEERRTAIGMD
YVRRTVLVEPEGLPREYTYSVFFCPNEDSDENHNEAFTLGVPHNIVPGSERATAFMIGDV
MGPTLNNLDKLLRLPFGCGEQNMIHFAPNVFVLKYLQKTRQLSPDVENEATDYLLQGYQR
QLTYKRQDGSYSAFGERDSSGSMWLTAFVLKSFAQSRGFIFIDPEELRAAKSWLITHQQS
DGSFPAMGRILNKDLQGGIHGKISLTAYVLAALLETGIATEEEKVAVAKAKDFLESNTYS
AEDPYTTALSAYALALLRSPYAPLALRRLNHMAITQGTATRTVSSPQPVSSRRLTHSVVS
AEVEMTAYGLLTYTLLGDVASALPVVKWLSQQRNSLGGFLLFSPQDTCVALQALSEYAIL
SYVGGVNLTISLASTNLDFQESFELNRDNKKLLQSARIPSIPTGLFVSAKGEGCCLMQID
VSYNLPDPVSKQLNRSRKRRAPIDDDDPAGHQDKLDFHISLEICARWLHSGSSNMAVIEV
PMISGFRVDVESLERLLMDKRVGLKRYDLNGRKVLFYFDEIPSQCMTCVAFKAVREYVVG
KTAPVPVKIYDYYEPAFEATRFYN
Download sequence
Identical sequences H3DDC7
ENSTNIP00000018520 ENSTNIP00000018519 99883.ENSTNIP00000018520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]