SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018523 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018523
Domain Number 1 Region: 1-89
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.75e-18
Family Ankyrin repeat 0.001
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000018523
Domain Number - Region: 278-336
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.0324
Family Seryl-tRNA synthetase (SerRS) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018523   Gene: ENSTNIG00000015452   Transcript: ENSTNIT00000018749
Sequence length 585
Comment pep:known_by_projection chromosome:TETRAODON8:1:14945313:14951931:-1 gene:ENSTNIG00000015452 transcript:ENSTNIT00000018749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DGSTPLILAAQMSRAELCAFLLGRGANANIQDNEDGRSALMLACESDSIETVQVLLRGGA
GTQLVDALGHKAADYSATAGNQRILQMLQHGPPPASGPSAALSGKPGKSPKAEDEEVFEE
IRRLRLERGRLLQKIKALEQQQQSALSALKELSQLKQRLMEAEAERDQLLEELKGGHGIG
SSESEDVDEMFDFSEKLLSKQSRACPAEVVSTSNGAPDSAQPSPAPADPGPDAELRKQIE
ELTSQNSELALKVQMLEMFEKDDTDMQASSSDFVPIAQYETLRREYEELQSCSNEKSQQG
VADAESVEALKEKLQGLKEQLAFSQTELKELREQMRLGVLSVECGLGSGTVEEGPSPEAQ
QLKLRVTQLEEELAQRCGDSDTVKQLTKKVEELQVALAGKHEKQNDSGGDDTETVKFLRG
RVAELEAALAQNRPSGTEGESRGGQKAQRCTAGPGETQTCSSCFRAAGSDAAGAPGGEGP
QRERGVQREALFNKSERQVAESQLATVQQQLAELQAKSSHIQELHKDIQESQGLVKEKDR
KDWEKKHKQVVTIYRSHLLAAVQGRMDAEVQGLLLQILRMSQQGQ
Download sequence
Identical sequences H3DDD0
99883.ENSTNIP00000018523 ENSTNIP00000018523 ENSTNIP00000002856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]