SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018558 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018558
Domain Number 1 Region: 9-162
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.53e-43
Family Ankyrin repeat 0.0000206
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018558   Gene: ENSTNIG00000015488   Transcript: ENSTNIT00000018785
Sequence length 166
Comment pep:known_by_projection chromosome:TETRAODON8:1:15618075:15619876:1 gene:ENSTNIG00000015488 transcript:ENSTNIT00000018785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTEMEDTVVDQLCKASAQGNLAAVKRLLQNGVDVNGLNTFNRTALQVVKTGHTALVLELL
LAGAEPNVADPACDLTVLHDASRDGFAASVQLLLQHGADANMADRRGNLPLHLAAEEGHP
EVVRLLMEHTENPQSRNKQGATALQLAGRRGRVDTVRYLLERLSPR
Download sequence
Identical sequences H3DDG5
ENSTNIP00000018558 ENSTNIP00000018558 99883.ENSTNIP00000018558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]