SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018562 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018562
Domain Number 1 Region: 22-219
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.38e-62
Family Calnexin/calreticulin 0.0000592
Further Details:      
 
Domain Number 2 Region: 203-317
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 2.35e-45
Family P-domain of calnexin/calreticulin 0.00000206
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000018562
Domain Number - Region: 308-350
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0949
Family Calnexin/calreticulin 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018562   Gene: ENSTNIG00000015492   Transcript: ENSTNIT00000018789
Sequence length 370
Comment pep:known_by_projection chromosome:TETRAODON8:1:15654434:15656806:-1 gene:ENSTNIG00000015492 transcript:ENSTNIT00000018789 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMAALPLVLWALTAASVLAEPAVYLREQFEDGDAWTRRWVESKHKSDYGKFVLTAGKFYG
DVEKDKGLQTSQDARFYAVSSRFDDFSNKGRALVVQFTVKHEQEIDCGGGYVKLFPSDLN
QEDMHGDSTYNIMFGPDICGPGTKKVHVIFNYKGKNHLINKDIRCKDDEFSHLYTLIVNP
DNSYEVKIDNKKVESGSLEDDWDFLPPRRIKDPEAKKPEDWDDREKVPDPEDKKPEDWDK
PEVIPDPDAKKPEDWDEEMDGEWEAPMVTNPDYKGEWKPREMDNPAYKGKWVHPEIDNPE
YTPDAQIYKYDSIGVIGLDLWQVKSGTIFDNFLITDDPKLAEEVGNETWGKTKLLTRALR
CPQDAEKKMK
Download sequence
Identical sequences H3DDG9
ENSTNIP00000018562 ENSTNIP00000018562 99883.ENSTNIP00000018562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]