SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018633 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018633
Domain Number 1 Region: 2-167
Classification Level Classification E-value
Superfamily RUN domain-like 2.09e-32
Family RUN domain 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000018633
Domain Number - Region: 645-663,810-862
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00156
Family Cytochrome c3-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018633   Gene: ENSTNIG00000015561   Transcript: ENSTNIT00000018860
Sequence length 878
Comment pep:known_by_projection chromosome:TETRAODON8:1:16662748:16673499:-1 gene:ENSTNIG00000015561 transcript:ENSTNIT00000018860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRREHWKLLSSLKTTVEGLVSTTNPNVWSRYGGLQRLHKDMNHILSNGLRNEQVYYKQRD
YWPFVWCVRYISPHLASHVEQFSHLEPVRSGGMKVAGESYKAERWLLHSLQVHMLSAQLR
PLLRHLEHTRKYYNDDAFLLSEPHVTAMFQCLEAVEQNNPKLLAQVDTVGLSPLKSSPVL
GLLKSQSLCVLPGAGGAWRSADSAVRGEALNRRLTMSNCSLREAVCTGHDSGDATGAGSH
SRIGTTPTSPAGCLGDPWVCVDNPGENERGVTPPLGPTSVPCISFTECSPHHSSQPDPGD
SGEGDYDDGPEYLAIGNLGSRRLSRSSTHSSDHSEPRDQSQQQGSRILPPNRRSSFSEGQ
KGPGRGVRGHARSFSDTGISTKLGRSDGSPGSGVSDGMFRKPSEGQSLISYLSEQDFGSC
ADLEKRSAENAHFSISESLIAAIELMKYNLQHQEEEGDSDSEIQQLKQKIRLRRQQIRRS
RMLPPATSQHILHSTDSGDSRRSSQESCQGLSDSGSVEEVEECELQDADIKRRASASSRS
FLSSESVSKSFLQSNSAESVAMGLLRQFEGMQLPAASELDWLPEHDAPQKLLPIPDSLPI
SPDDGEHADIYKLRIRVRGNLEWAPRPQIIFNIHPAPKRKIVVAKQNLPCAGCGTRIDPD
YIRRLRYCEYLGRYFCQCCHENAQAVVPGRVLRKWDFSKYYVSNFARDLLSKIAGDPLFN
LSDINSGLYKKVKGLEAVRVLRTQLCHMKNLFKTCRFSKEVLDKFDILPGHLTEDLHLFS
LNDLNAVRNGDLAPRMKELLKLGTMHVAGCVLCQAKGFVCEFCGNEKDIVFPFQLHKCQR
CQECHACYHRSCFRAGKDCPRCQRLAERRKRMARKNME
Download sequence
Identical sequences H3DDP0
ENSTNIP00000018633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]