SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018664 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018664
Domain Number 1 Region: 1842-2087
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.73e-53
Family Ankyrin repeat 0.0000000547
Further Details:      
 
Domain Number 2 Region: 856-987
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000155
Family Growth factor receptor domain 0.0097
Further Details:      
 
Domain Number 3 Region: 1145-1287
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000173
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 4 Region: 442-571
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000235
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 5 Region: 207-342
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000408
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 6 Region: 413-453
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000839
Family EGF-type module 0.00093
Further Details:      
 
Domain Number 7 Region: 1021-1058
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000949
Family EGF-type module 0.0041
Further Details:      
 
Domain Number 8 Region: 754-796
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000127
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 9 Region: 791-828
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000013
Family EGF-type module 0.01
Further Details:      
 
Domain Number 10 Region: 678-718
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000117
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 11 Region: 143-185
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000184
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 12 Region: 984-1025
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000397
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 13 Region: 831-868
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000134
Family EGF-type module 0.014
Further Details:      
 
Domain Number 14 Region: 105-142
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000135
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 15 Region: 1364-1404
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000164
Family EGF-type module 0.022
Further Details:      
 
Domain Number 16 Region: 1283-1328
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000375
Family EGF-type module 0.011
Further Details:      
 
Domain Number 17 Region: 570-608
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000529
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 18 Region: 604-635
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000712
Family EGF-type module 0.015
Further Details:      
 
Domain Number 19 Region: 376-418
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000175
Family EGF-type module 0.017
Further Details:      
 
Domain Number 20 Region: 62-104
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000317
Family EGF-type module 0.011
Further Details:      
 
Domain Number 21 Region: 334-375
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000373
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 22 Region: 1464-1497
Classification Level Classification E-value
Superfamily Notch domain 0.000000379
Family Notch domain 0.0051
Further Details:      
 
Domain Number 23 Region: 1504-1536
Classification Level Classification E-value
Superfamily Notch domain 0.000000562
Family Notch domain 0.0036
Further Details:      
 
Domain Number 24 Region: 716-758
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000167
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 25 Region: 1322-1361
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000219
Family EGF-type module 0.016
Further Details:      
 
Domain Number 26 Region: 1424-1455
Classification Level Classification E-value
Superfamily Notch domain 0.00000759
Family Notch domain 0.00093
Further Details:      
 
Domain Number 27 Region: 639-682
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000133
Family EGF-type module 0.0094
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000018664
Domain Number - Region: 30-61
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00255
Family EGF-type module 0.041
Further Details:      
 
Domain Number - Region: 1063-1080
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0289
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018664   Gene: ENSTNIG00000015591   Transcript: ENSTNIT00000018891
Sequence length 2456
Comment pep:known_by_projection chromosome:TETRAODON8:12:4926487:4953886:-1 gene:ENSTNIG00000015591 transcript:ENSTNIT00000018891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QQQHLYPFHHLYVKTCLCSLGAKSLRCSMPTESCLNQGRCEATPDGQCKCTDGYVGSSCQ
FHDPCTTAPCMNGGTCRASTKGNTVDFSCTCKLGFTDRHCQTPIIDACITSPCLNGGTCE
LEGLQTYKCRCPPGWSGKLCQQADPCASNPCANGGHCSAIESHYVCTCTPFFSGKTCKQD
VNECDVSPSLCKNDGVCINDVGGYRCKCPVEYTGKHCESRYLPCNPSPCHNGGTCIQKGE
TSYECSCVPGFTGTNCDSNIDDCPGHECQNGGTCLDGVNTYNCQCKPEFTGQLCTEDVDE
CQLMPNACQNGGTCHNSYGSYQCVCVNGWTGNDCSENIDDCVSAACYQGSTCHDRVASFH
CECPHGRTGLLCHLDNACINNPCQKGSNCDINPVTGNYSCICPPGYIGASCDQDFDECSL
GSNPCEHAGKCINTKGSFQCKCQRGYVGARCELDVNECMSNPCMNEATCLDKIGGFRCIC
MLGYTGEFCEIDTDECANSPCLNSGTCIDKINAFHCQCPTGFTGNICQIDIDECASTPCK
NGAKCTDGPNNYTCECTEGYTGRHCETDIECYSDPCHYGTCIDGLASFSCQCKPGYTGRL
CETNINECLSQPCRNGGTCQDRENAYICNCTKGTTESTVIINIDDCKINPCDYGTCIDNI
NGYCACEPVYTGMMCNINIDECAINPCHNGGTCLDGINTFTCVCPKGYHDATCLSQVNEC
LSNPCIHGHCEDKINGYNCLCDSGWSGKNCDINNNECESNPCMNGGTCKDMTSGYVCTCC
MGFTGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCILPYTGEICETLMAPCSSKPCKH
GGVCQESEDYQSFSCVCPEGWQGQTCEVDIKECVKSPCLNGATCQNTLGSYHCNCELGFT
GRNCETNIDDCNPNPCSNGGACVDEVNSFQCTCLPGFRGTKCEEDINECESNPCKNGANC
TDCVNSYTCTCPAGFSGIHCENNTPDCTESSCFNGGTCVDGINTFTCLCPAGFTGNYCQH
DINECDSKPCLNGGTCQDSYGTYKCTCLHGYTGLNCQNLVRWCDSSPCKNGGTCWQTRNY
LRSKQLSLTACIHIQFLIYYCLNYLRLTLNEKCHCLCIIHCDKPIIYYISWGFSNGDYKT
KKNIQCMPGYVGTNCSDEINECFSQPCQNGGTCIDLINTYKCSCPRGTQGVHCEINIDDC
NPFFDPLTKEPKCFNKGKCVDQVGGYQCICPAGYVGERCEGDVNECLSNPCDPRGTHSCI
QLTNNYRCECRTGYTGQHCDTVFDGCKGKPCRNGGTCAVASNTPHGFICKCPPGFTGATC
DYDAKACGSLNCRNGGTCISGSKSPKCLCSPSFTGPECQYPTDSPCNSNPCYNGGTCEYT
PEAPFYHCTCPTNFNGLRCHILDYSFLGGSGYDITPPPEVEVKCEISQCETAKHNKFCDA
LCNNHECGWDNGDCSLNFNDPWKNCSASLQCWRYFNDGKCDSQCDNAGCLYDGFDCQNLE
GQCNPLYDQYCKDHYADDHCDQGCNNAECEWDGLDCAKNVPEKIAVGQLVLVVHIAPEQL
LNNSFGFLRELSRVLRTNMIFRKDAKGKLMVYPYYGEEHELKKYNVKRSVDTWIKKSLYD
VAAGSSRTRRELDHLQVKGSVVYLEMDNRQCFQQSTECFQSTNDAAAFLGALASSFKLDV
PYTIEAVYSESKRNMDPQPSRELYPVYLVLAGVGLLAFLGVGMVAARKRRPEHGRLWLPE
GFKTTETSKKKRREPVGEDSVGLKPLKNTSDISFMDVTHNDWEDDKPSDAKRFRLIDEQA
ILEADNQTDHRQWTQQHLDAADLRVPSIAPTPPQGETENDCMDVNVRGPDGFTPLMIASC
SGGGLETGNSEEEEDASANVINDFIYQGANLHNQTDRTGETALHLAARYARSDAAKRLLE
ASADANIQDNMGRTPLHAAVAADAQGVFQILIRNRATDLDARMHDGTTPLILAARLAVEG
MVEELINCHADVNAADDFGKSALHWAAAVNNVEAAVVLLKNGANKDMQNNKEETPLFLAA
REGSYETAKVLLDHFANREITDHMERLPRDIAQERMHHDIVRLMDEYNLVQSPHMHAGSL
GTTLSPSLCSPNGYLGGIKQPPPQGQGHGKKARKPSTKGIACKDGKDMKVKKKNSQDGKS
GNLLDSSAVLSPVDSLESPHGYVSDVASPPMMTSPFQQSPSVSLNHLQGMSDPHLAVNHM
VMPNKQELARMQFDPLPPRLTHLPVSSSSGQGAMNGHCDWLSRMHSNMSQPGQFNPLRGA
PSGQGGLHQAGQHALMTSLRNGHPATSLSQLMNYQGIQSSRLGPQSHISNTTSGQSFISR
ELSSPEIQQGTANPSIPIHTILPQDTQFMPSSINQSIASTQFLTPPSQHSYSGPIDNTPN
HQVQVPDHPFLTPSPGSPDQWSSSSPHSNMSDWSEGISSPPTSMQSQIGPIPEPFK
Download sequence
Identical sequences H3DDS1
ENSTNIP00000018664 99883.ENSTNIP00000018664 ENSTNIP00000018664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]