SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018714 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018714
Domain Number 1 Region: 28-75
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 1.57e-18
Family Cysteine-rich DNA binding domain, (DM domain) 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018714   Gene: ENSTNIG00000015640   Transcript: ENSTNIT00000018941
Sequence length 280
Comment pep:known_by_projection chromosome:TETRAODON8:12:3962606:3974310:-1 gene:ENSTNIG00000015640 transcript:ENSTNIT00000018941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NPAAMSKEKKSKALSTGTVTPSKGLKPPRMPKCSRCRNHGFVSTLKGHKRFCSWRDCQCP
KCKLIVERQRVMAAQVALRRQQAQEEELGIWSLGPLPGAGVMVKNEPGAECCFTVEGRSQ
TSTSGPSSAVATASRTVPSSQPSAGARAHHEGQSDLLLESSFYHFYQPSCYPSYYSNLYN
YQQYQQMPHGDGRLQNHNVSYMHTYCPGAPYLSPGLSSTACVPPIFSMEDNNNGSCAQTL
GTTFSPSSLSTGPDSSMTCEATSEMANFTISSTVDGDATN
Download sequence
Identical sequences H3DDX1
ENSTNIP00000018714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]