SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018728 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018728
Domain Number 1 Region: 9-150
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.59e-41
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00061
Further Details:      
 
Domain Number 2 Region: 124-310
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.63e-39
Family Laminin G-like module 0.0032
Further Details:      
 
Domain Number 3 Region: 742-905
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.28e-35
Family Laminin G-like module 0.0022
Further Details:      
 
Domain Number 4 Region: 936-1142
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-31
Family Laminin G-like module 0.0077
Further Details:      
 
Domain Number 5 Region: 309-488
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.94e-30
Family Laminin G-like module 0.0032
Further Details:      
 
Domain Number 6 Region: 547-603
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.00000000254
Family Fibrinogen C-terminal domain-like 0.0049
Further Details:      
 
Domain Number 7 Region: 517-553
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000878
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018728   Gene: ENSTNIG00000015653   Transcript: ENSTNIT00000018955
Sequence length 1274
Comment pep:known_by_projection chromosome:TETRAODON8:2:19632993:19682900:-1 gene:ENSTNIG00000015653 transcript:ENSTNIT00000018955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NCNGPLLSTLPHSSFQGSSQSSSAHAARNTKLNRRDGAGGWSPMVTDQDPWLQVDLKEQM
EVTAVATQGRYDSWDWVTSYQLLYSDTGRVWKQYRQEDGVGKLIGNVNSEAVVQNRLSHP
VRTRFLRFVPLDWNPSGWMGLRVEVYGCSYKSYVADFDGRSSLLYRFNQKSMSTLKDVIS
LRFKSHQAEGVLLHGEGQRGDYITLELHRGRLDLYLNLDDSRPRFSSSRVAVTVGSLLDD
EHWHSVHIERFNKQVNLTVDSHTRHFQTRGEGHSLEVDYELSFGGIPLPGKPGTFLRKNF
HGCMENLYYNGINIIDLAKRRKLQIHSVGNVTFSCSQPQLVSCTFLSSSSSFLSLPAAAA
TGGFAVRFQFRTWNPDGLLLSLQLNPEPQRLELRISNSRLFLTLQNSGRQKSEVSVGQRV
NDGLWHSVSLDSRDLQIALGLDAESPSTVDLWQQLEPRGSIYFGGCPNKDYQRQTPTFQG
CMRLVFINGQPVNLSHVQQGLLGNYNELKFDTCNIRDRCLPNLCEHGGRCSQTWSSFSCD
CSGSGYSGSTCHNSIYESSCEAYKLIGSSSGYYSIDPDGSGPLGPTQVYCNMTEKKVWTL
LMHDGPAAVTVQGSSLLKPHVRKFNYSASAEQLRAIVSGSEQCQQEVVYNCRKSRLFNTK
DGSPMSWWLDREGERRSYWGGFLPGVQQCSCSLEENCADMNYFCNCDADREAWANDTGLL
SYKDHLPVSQIVIGDTNRTGSQAVYHVGPLRCYGDKSIWNAASFYQESSYLYFPTLQAEL
ASDISFYFKSSAPSGVFLENLGLKDFIRLELTSPSVVTFSFDVGNGPVVLSVKSHLPLND
RQWHYVRAERNVKEASLQVDQLPLRLLEAPADGHPRLKLSSQLFVGGTASQQRGFLGCIR
TLTINGASLDLEERAKMTPGVSSGCPGYCSGSSSLCHNRGRCIEKSNGYVCDCSQSAYGG
TTCNQEVSVSFDTESSVIYTFQEPFSVMQNRSSQASSVSTESSSRAREDVAFSFVTSQRP
AMLLTLSTFSQQYIAVILALNGSLQIWYHLQTDRSPDVFSPTLNNMADGRLHRVRIHRVG
KNLYVQIDQDIHTKYTLSSDAELILIRSLTLGKVTGRENFNEKVAQAASKGFVGCLSSVQ
FNHVAPLKAALMNRGSSLVTIRGPLVQSNCGSLAESTSHTLQVSADQTATANKDKEQHGN
SSQKDLAVIAGVVTAVVFISVCALAAISRLLYQQRRAQRTGSIKEENSQSMYTDYRTELH
LHNAVRDNMKEYYI
Download sequence
Identical sequences H3DDY5
ENSTNIP00000018728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]