SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018730 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018730
Domain Number 1 Region: 364-549
Classification Level Classification E-value
Superfamily ADP-ribosylation 5.56e-43
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.00043
Further Details:      
 
Domain Number 2 Region: 857-1009
Classification Level Classification E-value
Superfamily vWA-like 2.09e-16
Family Integrin A (or I) domain 0.056
Further Details:      
 
Domain Number 3 Region: 4-96
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000305
Family DNA topoisomerase II binding protein 1, TopBP1 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018730   Gene: ENSTNIG00000015654   Transcript: ENSTNIT00000018957
Sequence length 1195
Comment pep:known_by_projection chromosome:TETRAODON8:2:19792881:19799173:1 gene:ENSTNIG00000015654 transcript:ENSTNIT00000018957 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SMGVFTNCSVLVELKTLPIKEKRSLKAAITENGGTICFVVNKQCSLILTSDASSLSPNRL
RSIRKHQTPVVGVEYVSSCLERGALLPLDGYRLDAPPTPAPPTKRPSKDPVNPEVRKSQT
ANAPEQSGDLLGRFRVYGEDDSDLPPFPDRFQVAKYSIYEKSRSSSGWLLELQSLREEGG
RRLLIAKARLLEEAAVKEALVFPSTSEEALEVYECLRTSLLQSGLRQRRSLPAQARELGS
APLQQLLLEERLNTGTLTQEVGAFVELLWTEATGRLGDILTAPVEKLSLNDVSVAPRLQT
DFLRSPDPGQVSMGVKEDAYRLIPVSTRCPRSLDVCQLIRDLLNVSEMTLRSSAPSCLGK
YRALRCSLEAVPPNSSEFLDVAAQLQHSRVQIQQVLRVCRGVELQTFEADVGGIKPLLHS
SRPSNFVGLLSRGLLMPRVGVEHHGIERTDAGNLGSGIYFSDAFSTSLKYSHPGATDGSR
LLLVCDVALGRCQDVRKRDRTLSQAPDGYHSVHGVRSAPGAPSEFEDDEYVVYSPGQVRL
KYVVRFSMEGDQLKEFSPSVSTSAQPLPPPAVQELQSEEAEVVKNPVEDVKAGLLDSSGQ
QVPLQAVHVRCKLMDLLSQVTIFQKYTNQRPEPIEAKFVFPLSDSAAVCGFEAFINGKHV
VGQVKEKETARKEYKQAVERGHGAYLMDQDAPDVFTISVGNLPPAATVLVKVTFVSELVV
QGGSILFSLPGSVAPWQESAALNQTTQVTLEKVCVTEEEAASREFTLDACVEMPHEISRL
TCLTHSVKTKRTDCKAVVSVLPGQILGPEGFQLSVSLSKAHLPRMWVEKHPEKDSQACML
VFYPDFDIDAGSPPSNEVVLLLDTSESMRDSLHTLQEIALRVLKALHPDVKVNIILFGTD
HSEAFLTARPLGEAEGEVKSFVKRFTPVGGSTELWRPLRALSLLPPSRGLRNLLLLSDGH
VQNPELTLQLLRDGVQHSRLFPAASGLPTANRHMLRALAQAGGGAFEFFDTKSRHTWAEK
VACQVKRMAAPGCSSVSVKWQQFNPTAPPPVQAPKQLHALFRDCHTLVYGFVPHCTQATL
LGSLSGKELRTMVSTSELQKTRGTFLHKLTARAVIRDYEDGNLDADAAQHEGKKAELREF
VISLSKEFSILSQFTSFVAVEERGSAQDEGFTDVPKLIAEEDVDFLPYISWSSSQ
Download sequence
Identical sequences H3DDY7
ENSTNIP00000018730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]