SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018743 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018743
Domain Number 1 Region: 669-816,865-1019
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.86e-77
Family Protein kinases, catalytic subunit 0.00000324
Further Details:      
 
Domain Number 2 Region: 107-147
Classification Level Classification E-value
Superfamily UBA-like 4.15e-17
Family UBA domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018743   Gene: ENSTNIG00000015668   Transcript: ENSTNIT00000018971
Sequence length 1085
Comment pep:known_by_projection chromosome:TETRAODON8:2:19989930:19998608:1 gene:ENSTNIG00000015668 transcript:ENSTNIT00000018971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPKTFPAAPYVGNTRQRLQEIKEGLKQPAKLVSQALHGSGARAEGCRGADCKSGKDAAG
RQQQLRPPQKFNNYQNALREIRKSLMPFANESGPSSGSGHPPGAGEVNRQMLQELVNAGC
DQEMAVRALKQTGSRNIEAALEYISKMGYLDPRNELIVRVIKQTSPGKAGIPNSMDHRPP
LEASGEVGAMPPYHQMGAPLYEGPAGYSADGEIPRPYLSAGPHGPMMSYNVPGQPLQLQP
QPPGGPVPGPHYDYSHARPHMMDPGGYGVKRTASFQNKMAPPPMAPPDNYVNMQGKGAMG
QNGPGGGAAGGGGGYPANRYLPPHSHPRQASPTSHQVHMMSRSPGGVAAMGPDFSDIPQG
LMTPSRASLNLDLYEHHWAGPPGPEGAPPGRQPQPQGPFRGEVRVPSRTNSFNSRSAGPT
GVRPALTAPPTVAKQDPSLGPPNTITAVTSPPIQQPVKSIRVMRPEPKTAVGPCHPGWMS
AQTQDAGEPLAYMAEEPYPLEPAQEPRCPPPPYPKNLLMPGPSGETGGLEAAGAISAHGN
SSGGSGKAEESQGKEKTKTCKADKADKAVKDKKQIQTSPVPVRKNGRDEEKRESRIKTYS
PFAFKFYMEQHVENVMKTYHQKLNRLQLEQEMSKAGLSEAEQEQMRKMLNQKESNYNRLR
RAKMDKSMFVKIKTLGIGAFGEVCLTRKVDTCALYAMKTLRKKDVLNRNQVAHVKAELTS
CSEADNEWVVRLYYSFQDRENLYFVMDYIPGGDMMSLLIRMGVFPESLACFYVAELTLAI
ESVHKMGFIHRDIKPDNILIDLDGHIKLTDFGLCTGFRWTHNSKYYQKGSHVRQDSMEPS
DFWDDVSNCRCGDRLMTLEQRANRQHQRCLAHSLVGTPNYIAPEVLLRKGYTQLCDWWSV
GVILFEMLVGQPPFLAPTPTETQIKVINWESTLQVPAQVKLSPEAVDIIGRLCCSAGDRL
GANGAGEIKAHPFFSQIDFSSNLRQQPAPYRPKIAHPMDTSNFDPVEEEGGPGAWGDSGD
STRTLDLLCSPQGKHPEHAFYEFTFRRFFDDNGCPFRYPKPLEAFEASAHMTGATCLGGC
EPVYV
Download sequence
Identical sequences H3DE00
ENSTNIP00000018743 99883.ENSTNIP00000018743 ENSTNIP00000018743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]