SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018753 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018753
Domain Number 1 Region: 505-657
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.61e-33
Family Ankyrin repeat 0.00045
Further Details:      
 
Domain Number 2 Region: 4-63
Classification Level Classification E-value
Superfamily Chromo domain-like 3.88e-17
Family Chromo domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018753   Gene: ENSTNIG00000015678   Transcript: ENSTNIT00000018981
Sequence length 793
Comment pep:known_by_projection chromosome:TETRAODON8:2:20085497:20098283:-1 gene:ENSTNIG00000015678 transcript:ENSTNIT00000018981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSEQDEEDVYEVERIIDMRVEEGEVLYRVRWKNYCSDDDTWEPEAHLEDCHEVLLAFKN
SVADAKLKKEPEAKKLTKVLPTKSDVFDADSESDGDRQHPSEAPTRKELNPESIRSTPMR
MKMNPSPPKNVPASTAEKTQLDKCKQKKGKWEVKLQGIQDFSDSSLKESSLQKLKGLTSK
SKDEAAPHSDSSDSSTLHKKAKSKGQDSASALCKAPSSTASSSSSSSAAAGPTRAKEEEL
IKEDLVGQKDAPGSTNLFEKFLLHCEAKDRVPRRPPAHPAPAEKSSSKPAKSLNSLLERL
RRSQSQPKTPQLRGLSPRKRRRPSSPTFWFFCFILLITAEKYSFCDVVCDLCDCPPAPRS
GQSHGFSLDSDEKEGEEPTLKLRPGEERSSWERRTPTEDRRRKREDSEPRLFMACDDGQE
TQDPLEGADKSGMTGNSTTFTSAVSEMCPRLSVSCPIMCRADKVQATLSLGMDLNLDWMT
LDDFQKHLNGEDEILSGPPLSPSELRDAVKSGHYMTVKLALNSKEEYNLDQEDVSGMSLS
MLAAAGGHDDILRLLIRKGVRVNNRQKNGTTALMHAAEKNFLTTVAILLEAGSYVNAQTL
TGETALMKACKRGNADVVRLLLEYGADCNISSKHKNTAMYFAKLSNNLLLCDLIKDHVNI
LSSVAEDTIRAYFESRLVLLEAVFPLACHRLCEGPDFSLEFGFKSQPQPEGSGILLFIFH
ANFLGEITARLSGPCSVHAVVLNDKFQLPIFLDSHFIYSFSPIPGINRLFIRLAEAPTAK
VKLLICAYKVQLQ
Download sequence
Identical sequences H3DE10
99883.ENSTNIP00000018753 ENSTNIP00000018753 ENSTNIP00000018753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]