SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018784 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018784
Domain Number 1 Region: 4-132
Classification Level Classification E-value
Superfamily vWA-like 0.0000000011
Family Ku80 subunit N-terminal domain 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018784   Gene: ENSTNIG00000015709   Transcript: ENSTNIT00000019012
Sequence length 861
Comment pep:known_by_projection chromosome:TETRAODON8:2:20630723:20639010:-1 gene:ENSTNIG00000015709 transcript:ENSTNIT00000019012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVLLFLIDTSASMNQRTHLGTTYLDIAKGAVETFIKLRGRDPASRGDRYMLVNFEDVPY
GIKAGWKESHATFMTELRNLQATGLTTIGQSLRNAFDLLNLNRLVTGIDNYGQGRNPFFL
EPAIIIAISDGNKLTSGSGVQEELHLPLTTPLPGSELTKEPFRWDQRLFALVLRIPGNAS
VEPEPVGGVPPDDSPITPMCEVTGGRSYSVFSQRTLNQCLESLVQKIQSGVVIKFEKTGP
DPPPLEADAPAEAQKSGVQPWHCCHKLIYVRPNPKTGVPIGHWPIPEAFWPDQNSPTLPP
RSAHPHVRFSCLDAEPMVIDKVPFDKYELEPSPLTQYILERKSPHTCWQVFVCNSAKYSD
LGQPFGYLKASTALNCVNLFVMPYNYPVLLPLLDDLIKVHKFKPTLKWRQSFENYLKTMP
PYYIGSLRKALRIMGAPNLLADNMEYGLSYSVVSYLKKLSQQSKIEYDRLISSIGKKLPA
EAGIKVRWRGGGISLAQRRDFIQQLQSLTGDGPSLPLELNPKEFQGFHLAMLNKGLKPQS
FRNPYDIPRSHLLDQLSRMRRNLLNTSVCTLRGQDSDQLHSVPIAQMGNYQDFLKSAPQP
LRDADPEQPKRLHTFGNPFKLDKKGMMIDEADEFVTGPQSKGKRPGDSSNNTGGGGPKRR
RCMSPLLRLGRAYTPPVSPPASPRPAAASLVLNVHFADEDSSDSSPESDPMANHLTQNHY
GADGGPDSEADRSSGPADHQENHAEAGDGRLRDEQGMAEEHPARYLSAVSLKQRIHTETT
KVNNELRALITKEIRKPGRHYEKIFLLLKQIQGTLDTRLIFLQNIIKEAARFKKRVLIEQ
LENFLEEIHSRANNINHVDSL
Download sequence
Identical sequences H3DE41
99883.ENSTNIP00000018784 ENSTNIP00000018784 ENSTNIP00000018784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]