SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018795 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018795
Domain Number 1 Region: 92-375
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 2.81e-68
Family Glutaminase 0.0000448
Further Details:      
 
Domain Number 2 Region: 400-484
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.71e-16
Family Ankyrin repeat 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018795   Gene: ENSTNIG00000015720   Transcript: ENSTNIT00000019023
Sequence length 490
Comment pep:known_by_projection chromosome:TETRAODON8:2:20698123:20705831:1 gene:ENSTNIG00000015720 transcript:ENSTNIT00000019023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NSDILPSLEDLLFYTVAEGEEKIPVHKFLTALKATGLSTADPRLKECMETLQEVKNTEDG
LTLDRDLFKKCVQSNIVLLTQAFRKKFVIPDFQAFTSHIDDLYQSSRALSGGQVADYIPQ
LAKFSPELWAVSLCTVDGQRHTIGDSKVPFCLQSCVKPLKYAIAVNDHGTEYVHSFIGKE
PSGLRFNKLFLNEEGEPPCLWVSQAYIYVNFYCVLNKPRQLKGRFLQFLSLSFSSAVLKV
ADVHSKVHLKPPLKLKGKGFTRLYYQQRRFKIKEEQRHLSFVIYEMNGERVLSPEAVRNT
LSLMHSCGMYDFSGQFAFHVGLPAKSGVSGGILLVVPNVMGVMCWSPPLDKLGNSVRGIR
FCTDLVELFNFHNYDNLRHFAKKYDPRREGGEQRVKSVINLLFAAYTGDITALRRLALSS
MDMEQKDYDSRTALHVAAAEGHAEAVRFLLEACRVNPVPKDRWGKTPLDEAMHFCHHDVA
DILRRGQETY
Download sequence
Identical sequences H3DE52
ENSTNIP00000018795 ENSTNIP00000018795 99883.ENSTNIP00000018795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]