SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018832 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018832
Domain Number 1 Region: 431-555
Classification Level Classification E-value
Superfamily Cadherin-like 7.85e-30
Family Cadherin 0.0016
Further Details:      
 
Domain Number 2 Region: 216-339
Classification Level Classification E-value
Superfamily Cadherin-like 9.71e-30
Family Cadherin 0.0016
Further Details:      
 
Domain Number 3 Region: 113-220
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-22
Family Cadherin 0.0029
Further Details:      
 
Domain Number 4 Region: 330-435
Classification Level Classification E-value
Superfamily Cadherin-like 1.07e-21
Family Cadherin 0.0054
Further Details:      
 
Domain Number 5 Region: 545-651
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-21
Family Cadherin 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018832   Gene: ENSTNIG00000015756   Transcript: ENSTNIT00000019060
Sequence length 814
Comment pep:known_by_projection chromosome:TETRAODON8:1:4491534:4495906:1 gene:ENSTNIG00000015756 transcript:ENSTNIT00000019060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IVPFLLFLVGTEAVINLKYGINEEMKPGSVIGNVTKDALKQGFQIAPQPPYLRVISNSEP
RWVELSPAGILTTQMKIDRDVVCRQNPKCVISLEVMSNSMEICVIKVEIEDLNDNAPRFP
TNHIDIEISENASPGTRFPLEGASDPDSGIFGVQSYSITPNELFGLEIKTRGDGSKIAEL
VVQKSLDRETQSHYTYEISAEDGGDPPKIGAVQLNIKVIDSNDNNPVFDEAVYTVNVMEN
SPINTIVIDLNATDPDEGTNGEIVYSFHSYVTEKTRDAFKIDPRTGIITVNGVLDYETAQ
IYEIDVQAKDLGPNSIPAHCKVTVNVMDTNDNPPVISLLSLNTEMVEVSENAQRGYVIAL
VRVSDKDSGANGKVQCRLQGNVPFRLQEYESFSTILVDGRLDREQKDTYNLTIQAEDSGM
PPLRATKSLVVKVTDENDNPPHFLKPHYQEMVMENNLPGSCLLAVSAEDPDLGMNGTVSY
SIVPGEIKHMDVNTYVSINPSGRIYSMRSFDHEYTRTFDFKVLARDNGNPSLSSNATVRI
VVLDVNDNTPVMTNPPLVNGTAEVSIPRNAGVGFMVTQVKADDYDEGENGRLTYTISEGD
RAFFEIDQVNGEVRSTRMFGENAKSTYEITVVARDHGKPSLSASAYIVVYLSPDLNAQET
IGPVNLSLIFIIALGSIAAILFVTMIFVAVKCKRDNKEIRTYNCSGAACVLCLCGFGNQK
KSSKKKKLSKNDIRLVPRDVEETDKMNVVSCSSLTSSLNYFDYHQQSLPLGCRRSESTFL
NVENQNSRNAAPNHGYQHTFTGQGHQQPDLIING
Download sequence
Identical sequences H3DE89
ENSTNIP00000018832 ENSTNIP00000018832 99883.ENSTNIP00000018832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]