SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018857 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018857
Domain Number 1 Region: 1013-1084,1117-1197,1237-1336
Classification Level Classification E-value
Superfamily YWTD domain 3.66e-23
Family YWTD domain 0.013
Further Details:      
 
Domain Number 2 Region: 1306-1544
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.00000471
Family DPP6 N-terminal domain-like 0.026
Further Details:      
 
Domain Number 3 Region: 498-523
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000733
Family Integrin beta EGF-like domains 0.051
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000018857
Domain Number - Region: 432-457
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000105
Family Integrin beta EGF-like domains 0.077
Further Details:      
 
Domain Number - Region: 529-554
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00012
Family Integrin beta EGF-like domains 0.067
Further Details:      
 
Domain Number - Region: 687-758
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000133
Family Pre-dockerin domain 0.068
Further Details:      
 
Domain Number - Region: 366-392
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00309
Family Integrin beta EGF-like domains 0.051
Further Details:      
 
Domain Number - Region: 337-360
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00429
Family EGF-type module 0.049
Further Details:      
 
Domain Number - Region: 400-424
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00524
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 554-594
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00838
Family Integrin beta EGF-like domains 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018857   Gene: ENSTNIG00000015779   Transcript: ENSTNIT00000019085
Sequence length 2497
Comment pep:known_by_projection chromosome:TETRAODON8:1:4019420:4107872:1 gene:ENSTNIG00000015779 transcript:ENSTNIT00000019085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPPPPPPPHACTCARPAPYAQVSLQRKTMPTRCQTSQGSQGGDTGSSTDQAQLHNSWVLN
SNIPLETRQFLFKQGSGSSALLSGAGQGYPLTSGTVYSPPPRPLPRSSVTRPLFTFNKPH
RCCNWKCTALSASLLTLTLALLLTYVIVVHLLGLTWHLRHGESQLYENGVSSGDHQQDDQ
CKMKEGGKEKWVRGRAIDRGEIEIGTQQSQTVPPGLFWRFHMTVHHPTYVKFNLSLSHNA
LLGVYGRRNIPPTHTQFDFVKLLDGKALPKSLTDPVSNAKAPKGLLLNNLQETGFIEYMD
PGTWHLALYNDGRNLEQVLLHSTPIGEDSMDGCSSDCNGNGECVAGHCHCFPGFLGPDCA
KDSCPVLCSGNGVYEKGRCVCLAGWKGAECNVEGQCIDPTCSNHGSCIQGICICSPAYKG
VNCEQVDCTDPQCGGHGVCVRGECVCSAGWTGVNCDDPLPACQEQCSGHGTYLPESDTCA
CQPNWTGPDCYTELCAVPCGSHGACSEGQCQCEEGWTGAACDQRACHPRCEEHGQCHDGT
CICQPGWEGEHCNIDGCPGLCSGHGRCTLEQSGWRCVCQTGWSGPGCSVVMETDCSDGAD
NDGDGLIDCVDPDCCEQLSCGSDPLCHGSADPLVLLQQSLPSTIAAPSPLSTHTQSFYQR
IRFLLGKAATHTLPGDVPFDTSRVSVIRGGVALQDGSPLVGVNITFPQHPEYGYSISRKD
GSFDLVTMGAMSVTLMFQRPPFLTQTRTILTPNNNFLVLEQVTMSREESQAAKCDIRSLL
SPYPLVLPHPLPKYAAACAEKGPAVPELQVVQEEVSIPGAFVKLNYLSSRAAGYLSMLRI
LLTPPSPLSPVSPLGGLSKVHVRASVEGRLYQRWYPAGPGLVHRLVWNKTDVYGQEVWGL
TYATVSVGYEYESCSGVIQWERRTALMQGFELVPSNLGGWSLDKHHALNLRSGILHKGNG
ENVYLSQQPPVISTVMGNGFYRSVPCGPSCSGAARDMMLFAPVALASPDGSLYVGDFNFI
RRVHPDGHTRTILELKNRDTRHRSTSPAHKYYLAMDPIGEVLYVSDTTSRRVYRVRNLGQ
PKDPSRNLEVVAGTGEQCLPFDQSHCGEGRKATEAALNNPRGIAVDKRGIVYFVDGTTIQ
KINERGLLSTVIGSNGLMSTQPLSCDARMDISQVRLEWPTDLAINPLDNSLYILDNNIVL
QVSESLHVRIVAGRPIHCQVPGIDHHLVKWAAVRATLEAAKAIALSHLGTLYIAETDERR
INRIQQVSTNGEISVISGAPSECDCKIDPNCDCFSGDGGYARDARLKAPSALAVAPNGTL
YIADLGNIRIRAVSPNQPQANPAGLVEISSPLDQELYLFSQNGSHMHTKHMVTGHYLYNF
SYGADGQLSGLMSRDGRGLQVRRDAHGVPLWLALPGGQVYWLSLSNSGTLRKVSAQGHDI
AHITYHGNTGLLATKSDENSWTTVYEYSNEGRVTNITLPTGEVSGFHSNLERWSRVEVEA
STRENFVTSTNLSAGDTIYTFRQDHAQSTYRVSADGSFLVTLASGMELSLSTEPLLLGGF
GGGVSPTASRCNISLPGDHAPSLIEWRQRKEQSKTNYSTYERRLRAHNRNLLSIDFDQST
RVGKIYDDHRKFTLHIQYDSLGRPVVWSPSSKYTEVNITYSGGGLVSAINRGDWSERLEY
ENDKVVSRAWVNGKIWSYTYADRSVMLLLHSQRRYVFEYDQTDRLVAVTMPSMVKHTLQS
LLSIGYYRNIHPPPDSQASFVQDLTLDGRLLKTQYLGTGRSVIYRYTPAARLSEVVYDST
LVTFTYDDTSGTVKTIHLTHNGFSSSIRYRQTGPLTSRQIFRFSEEGLVTARFDYSYNNF
KVTSMQAVINETPLPIDLYRYVDVSGRVEFGKFSVIFYDLNQVITTHLMKHTKVFNSYGQ
VVEVQYEILKSIAFWMTVQYDNAGRTTTCDIRVGVDSNVTRYTYEYDADSQLQSASVNER
PQWRYSYDLNGNINLLSLGTSARLTPLRYDQRDRITHLGELQYVVDEDGFLRQRANDLFD
YNSNGLLTRVYNRMSKHTVWYRYDGLGRRVATKSSQGEQLQFFYADLSQPTRVSHLYNHS
SNLITSLYYDLQGQLIAMELSSGEEYYVACDSVGSPRAVFSSKGRLVKEIFYTPYGEVYQ
DTNPDFQLVIGFHGGLYDPSTRLVHLGRRDYDTLAGRWTSPNHELWGELSKEPKPFNLYT
FKNNCPSGRVEEVTQFTTADIGSWLQLFGFQLHNVVPGFSKPEVGRLEQTYELMKTQTQN
WDSSKVVLGIQCELRRQLRSFISLERLPLVSQPVGSTNHRPLRPPPFGSRPSLLGPSIRF
AVSRGRISAEVIGVASEDSRRVAAILNGALHLSGLSFTVHGCDTHHFLQSRPIEEDLALG
LGVGGRVLEGGVNVSVSQMSAVVSGRTRRFADITLQQGALCLCVRYAWSEAEKQQLLSEG
RVQGYDGYYSLPIEKQPELCDSSANIHFMTLSEVGGR
Download sequence
Identical sequences H3DEB4
ENSTNIP00000018857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]