SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018858 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018858
Domain Number 1 Region: 1048-1118,1151-1231,1271-1370
Classification Level Classification E-value
Superfamily YWTD domain 3.79e-23
Family YWTD domain 0.013
Further Details:      
 
Domain Number 2 Region: 1340-1578
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.00000384
Family DPP6 N-terminal domain-like 0.026
Further Details:      
 
Domain Number 3 Region: 553-578
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000438
Family Integrin beta EGF-like domains 0.067
Further Details:      
 
Domain Number 4 Region: 522-547
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000652
Family Integrin beta EGF-like domains 0.051
Further Details:      
 
Domain Number 5 Region: 456-481
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000978
Family Integrin beta EGF-like domains 0.057
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000018858
Domain Number - Region: 721-792
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000137
Family Pre-dockerin domain 0.068
Further Details:      
 
Domain Number - Region: 390-416
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00279
Family Integrin beta EGF-like domains 0.051
Further Details:      
 
Domain Number - Region: 590-624
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00288
Family Integrin beta EGF-like domains 0.082
Further Details:      
 
Domain Number - Region: 361-384
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00414
Family EGF-type module 0.051
Further Details:      
 
Domain Number - Region: 424-448
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00466
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018858   Gene: ENSTNIG00000015779   Transcript: ENSTNIT00000019086
Sequence length 2531
Comment pep:known_by_projection chromosome:TETRAODON8:1:4019378:4107872:1 gene:ENSTNIG00000015779 transcript:ENSTNIT00000019086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELPSSPGGQFTFRPLPPPPPPPHACTCARPAPYAQVSLQRKTMPTRCQTSQGSQGGDTGS
STDQAQLHNSWVLNSNIPLETRQFLFKQGSGSSALLSGAGQGYPLTSGTVYSPPPRPLPR
SSVTRPLFTFNKPHRCCNWKCTALSASLLTLTLALLLTYVIVVHLLGLTWHLRHGESQLY
ENGVSSGDHQKERLGLTINPVSIEVEDKGEKKEKWVRGRAIDRGEIEIGTQQSQTVPPGL
FWRFHMTVHHPTYVKFNLSLSHNALLGVYGRRNIPPTHTQFDFVKLLDGKALPKSLTDPV
SNAKAPKGLLLNNLQETGFIEYMDPGTWHLALYNDGRNLEQVLLHSTPIGEDSMDGCSSD
CNGNGECVAGHCHCFPGFLGPDCAKDSCPVLCSGNGVYEKGRCVCLAGWKGAECNVEGQC
IDPTCSNHGSCIQGICICSPAYKGVNCEQVDCTDPQCGGHGVCVRGECVCSAGWTGVNCD
DPLPACQEQCSGHGTYLPESDTCACQPNWTGPDCYTELCAVPCGSHGACSEGQCQCEEGW
TGAACDQRACHPRCEEHGQCHDGTCICQPGWEGEHCNIVTHDLDVVVKDGCPGLCSGHGR
CTLEQSGWRCVCQTGWSGPGCSVVMETDCSDGADNDGDGLIDCVDPDCCEQLSCGSDPLC
HGSADPLVLLQQSLPSTIAAPSPLSTHTQSFYQRIRFLLGKAATHTLPGDVPFDTSRVSV
IRGGVALQDGSPLVGVNITFPQHPEYGYSISRKDGSFDLVTMGAMSVTLMFQRPPFLTQT
RTILTPNNNFLVLEQVTMSREESQAAKCDIRSLLSPYPLVLPHPLPKYAAACAEKGPAVP
ELQVVQEEVSIPGAFVKLNYLSSRAAGYLSMLRILLTPPSPLSPVSPLGGLSKVHVRASV
EGRLYQRWYPAGPGLVHRLVWNKTDVYGQEVWGLTYATVSVGYEYESCSGVIQWERRTAL
MQGFELVPSNLGGWSLDKHHALNLRSGILHKGNGENVYLSQQPPVISTVMGNGFYRSVPC
GPSCSGAARDMMLFAPVALASPDGSLYVGDFNFIRRVHPDGHTRTILELKNRDTRHRSTS
PAHKYYLAMDPIGEVLYVSDTTSRRVYRVRNLGQPKDPSRNLEVVAGTGEQCLPFDQSHC
GEGRKATEAALNNPRGIAVDKRGIVYFVDGTTIQKINERGLLSTVIGSNGLMSTQPLSCD
ARMDISQVRLEWPTDLAINPLDNSLYILDNNIVLQVSESLHVRIVAGRPIHCQVPGIDHH
LVKWAAVRATLEAAKAIALSHLGTLYIAETDERRINRIQQVSTNGEISVISGAPSECDCK
IDPNCDCFSGDGGYARDARLKAPSALAVAPNGTLYIADLGNIRIRAVSPNQPQANPAGLV
EISSPLDQELYLFSQNGSHMHTKHMVTGHYLYNFSYGADGQLSGLMSRDGRGLQVRRDAH
GVPLWLALPGGQVYWLSLSNSGTLRKVSAQGHDIAHITYHGNTGLLATKSDENSWTTVYE
YSNEGRVTNITLPTGEVSGFHSNLERWSRVEVEASTRENFVTSTNLSAGDTIYTFRQDHA
QSTYRVSADGSFLVTLASGMELSLSTEPLLLGGFGGGVSPTASRCNISLPGDHAPSLIEW
RQRKEQSKTNYSTYERRLRAHNRNLLSIDFDQSTRVGKIYDDHRKFTLHIQYDSLGRPVV
WSPSSKYTEVNITYSGGGLVSAINRGDWSERLEYENDKVVSRAWVNGKIWSYTYADRSVM
LLLHSQRRYVFEYDQTDRLVAVTMPSMVKHTLQSLLSIGYYRNIHPPPDSQASFVQDLTL
DGRLLKTQYLGTGRSVIYRYTPAARLSEVVYDSTLVTFTYDDTSGTVKTIHLTHNGFSSS
IRYRQTGPLTSRQIFRFSEEGLVTARFDYSYNNFKVTSMQAVINETPLPIDLYRYVDVSG
RVEFGKFSVIFYDLNQVITTHLMKHTKVFNSYGQVVEVQYEILKSIAFWMTVQYDNAGRT
TTCDIRVGVDSNVTRYTYEYDADSQLQSASVNERPQWRYSYDLNGNINLLSLGTSARLTP
LRYDQRDRITHLGELQYVVDEDGFLRQRANDLFDYNSNGLLTRVYNRMSKHTVWYRYDGL
GRRVATKSSQGEQLQFFYADLSQPTRVSHLYNHSSNLITSLYYDLQGQLIAMELSSGEEY
YVACDSVGSPRAVFSSKGRLVKEIFYTPYGEVYQDTNPDFQLVIGFHGGLYDPSTRLVHL
GRRDYDTLAGRWTSPNHELWGELSKEPKPFNLYTFKNNCPSGRVEEVTQFTTADIGSWLQ
LFGFQLHNVVPGFSKPEVGRLEQTYELMKTQTQNWDSSKVVLGIQCELRRQLRSFISLER
LPLVSQPVGSTNHRPLRPPPFGSRPSLLGPSIRFAVSRGRISAEVIGVASEDSRRVAAIL
NGALHLSGLSFTVHGCDTHHFLQSRPIEEDLALGLGVGGRVLEGGVNVSVSQMSAVVSGR
TRRFADITLQQGALCLCVRYAWSEAEKQQLLSEGRVQGYDGYYSLPIEKQPELCDSSANI
HFMTLSEVGGR
Download sequence
Identical sequences H3DEB5
ENSTNIP00000018858 99883.ENSTNIP00000018858 ENSTNIP00000018857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]