SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018863 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018863
Domain Number 1 Region: 197-335
Classification Level Classification E-value
Superfamily PH domain-like 1.99e-41
Family Third domain of FERM 0.000000401
Further Details:      
 
Domain Number 2 Region: 86-196
Classification Level Classification E-value
Superfamily Second domain of FERM 1.7e-34
Family Second domain of FERM 0.000002
Further Details:      
 
Domain Number 3 Region: 492-579
Classification Level Classification E-value
Superfamily Moesin tail domain 4.32e-33
Family Moesin tail domain 0.0000204
Further Details:      
 
Domain Number 4 Region: 2-84
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.89e-23
Family First domain of FERM 0.0000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018863   Gene: ENSTNIG00000015782   Transcript: ENSTNIT00000019091
Sequence length 579
Comment pep:known_by_projection chromosome:TETRAODON8:1:3849921:3855132:-1 gene:ENSTNIG00000015782 transcript:ENSTNIT00000019091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QINVRVTTMDAELEFAILPSTTGKQLFDQIVKTIGLRETWFFGLQYKDSKGFSTWLKLNK
RVTAQDVKRENPLLIKFRARFYPEDVAEELIQEATQRLFFLQVKESILNDDIYCPPETAV
LLASYAVQVKQGDYRKDYHVPGYLSKEKLLPQSRVLEQHKLNKDQWEERIRVWHEEHKGM
LREDAVVEYLKIAQDLEMYGVNYFNIKNKKGSELWLGVDALGLNIYDKKDSRMTPKIGFP
WSEIRNISFNDKKFVIKAIDKKSPDFVFYVPRLRINKRILALCIGNHDLYMRRRKPDTIE
VQQMKAQAREEKSKRQLEKALLESEKKKRENAEKETEKIARETMELMERLRQIEEQTKRA
QDELEEQTRKALELEKERKIAQEEAERLDQERQAAVEVKAALLQHSETQIKNQESLATEL
AELTSKISQLEDAKKTKDEEAKKWQKRAIMVEADLERTKEVLKTKLVGVHIQDSVHTHMQ
EHDETDESSAEASAELTAPGMVWDRSEEERVTEAQKNQRLQENLKFLSTELAAAVDESKK
TPNDLIHAENVKAGRDKYKTLRQIRQGNTKQRIDEFESM
Download sequence
Identical sequences H3DEC0
ENSTNIP00000018863 ENSTNIP00000018863 99883.ENSTNIP00000018863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]