SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018871 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018871
Domain Number 1 Region: 794-884,910-1019,1099-1118
Classification Level Classification E-value
Superfamily NHL repeat 1.39e-18
Family NHL repeat 0.005
Further Details:      
 
Domain Number 2 Region: 970-1068,1096-1234
Classification Level Classification E-value
Superfamily NHL repeat 0.0000000392
Family NHL repeat 0.0073
Further Details:      
 
Domain Number 3 Region: 489-562
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000000484
Family Pre-dockerin domain 0.05
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000018871
Domain Number - Region: 201-226
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000251
Family EGF-type module 0.079
Further Details:      
 
Domain Number - Region: 330-356
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000298
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 167-194
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00034
Family Integrin beta EGF-like domains 0.049
Further Details:      
 
Domain Number - Region: 234-260
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00045
Family EGF-type module 0.034
Further Details:      
 
Domain Number - Region: 301-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00209
Family EGF-type module 0.06
Further Details:      
 
Domain Number - Region: 366-401
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00556
Family EGF-type module 0.085
Further Details:      
 
Domain Number - Region: 137-161
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0131
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 2152-2212
Classification Level Classification E-value
Superfamily Cytokine 0.0233
Family Interleukin-1 (IL-1) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018871   Gene: ENSTNIG00000015790   Transcript: ENSTNIT00000019099
Sequence length 2336
Comment pep:known_by_projection chromosome:TETRAODON8:1:3680401:3705775:1 gene:ENSTNIG00000015790 transcript:ENSTNIT00000019099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NSSIDMGSIEVGRRVTQEVPPGVFWRSLLHLSLPQFLKFNISLGKDALFGVYIRKGLPPS
HAQYDYMERLDGKEKWSVVESPRERRSIQTVVLNEAVFVQYLDAGSWHLAFYNDGREMET
VSFSTNIMDSVQECPRNCHGNGECNSGVCHCFPGFHGMDCSKAACPVLCSGNGQYDKGSC
VCYSGWKGPECDVPITQCIDPLCSGHGSCTDGNCVCSIGYKGQSCGEVDCLDPTCSNNGI
CVNGECHCKPGWGGLHCELPRAQCPDQCHGHGAFIPDTGLCSCDPNWMGPDCSMEVCSVD
CGTHGVCMGGACRCEDGWTGAGCDQRVCNPLCIKHGTCKDGKCQCHQGWNGEHCTIALYL
SAKVKHGCPNFCNGNGQCTMGQQSWHCECQTGWRGPGCSVAMETSCADNKDNEGDGLTDC
MDPDCCIQSPCQNSPLCRGSRDPLQVIQQGSLSQHRVRFYDRVRMLMGRESTHILPGDNP
FNSSLVSLIRGQVLTTDGTPLVGVNVSFVNYPHYGYTLTRQDGMFDLIANGGASLTLRFE
RAPFLSQERTVWLPWSQFYAMDTLVLKTEENTIPGCDLSGFVRPDPLVIASPLSSFFSSK
PGEKPIIPETQVLHEQIELPGTSLKLCYLSSRTQGYRSLLKVTMTPAVLSIDLLKVHLMV
AVEGHLFQKWFHASPNMSYTYIWDKTDAYGQRVYGLSEAVVSVGYEYESCASLILWEKRT
VILQGYELDPSSLGGWSLNKHHILNTRSGILHKGSGENIFVTEQPPVITSIMGNGRRRSI
SCPSCNGLADGNKLLAPVALAMGIDGSLYVGDLNFVRRVYPSMNTTAILELRNKDFRHSN
NPTHKYFLAVDPVTGALFISDTNSRRIYRVRSLTGGRLLSDNAEVVAGTGEQCLPFDERC
GDGGKATEATLMSPKGIAVDKNGLMYFVDATMIRKVDQNGIISTLLGANDLTAIRPLSCD
SSMDVSQVRLEWPTDLAVNPTDNSLYVLENNVILRITENHQVSIIAGRPMHCQVPGVDYS
LSKLAIHAALESATAVAPVAHRTLLYIETDEKKINRVRQVSTNGEISLLAGSPSDCDCKN
DVNCNCFYGDDGYAPEAGLNSPTSLAVSPDGTLFIADLNNIRIRAVRANRPGPAVSSVGY
GGIAQYEVASPREQELYIFNGEGLHIQTISLVTGEPLYNFTYGPDGELAMLTDNCNNTVK
VRRDGQGQGGGAGLLRLVLLPENQVLTLGLDPNGGLRSILALGQEVSLMTYSGSTGLLAT
KADETGWTTFYQYDSEGRLTNVTYPTGMVTSLHREIERSINIDIESSSREGDITVITNLS
SVEASYTVVQDQVRNSYQLCNNGTLRVRYANGMGISFHTEPHILTGSVSPTIGRRNITLP
TDNGLNSIEWRLRKEQIKGKVTVFGRKLRAHGRNLLSIDFDRNTRTEKIYDDHRKFTLRI
MYDTQGRPAMWLPSSSLAVVNVSYSSTGQLVGLQRGSMSERTEFDLQGRVVSRSFVDGKV
WSYSYLDKSMVLLLQSQRQYIFEFDGSGRVTAVTMPSVARHTMYTHVSVGYIRNTYNPPE
SNASIIHDYSEDGRPLAIHCLGTGRRVLYKHAKLGKLSEIVYDSTAVTFGYDETTGVLKS
VNLQNGGFSCTIRYRKMGPLIDKQMYRFSEEGMVNGRFEYTYHDNSFRIASMKPVISEMP
LPVDLYRYDEISGKVEHFGKFGVIYYDINQIITTAVMTLSKHFDTHGRIKEVQYEIFRSL
MYWMTVQYDSMGRVVKRELKIGPYANTTQYRYDYDGDGQLSGVKVNDWSTWRYSYDLNGN
LHLLNPGNSARILPLRYDLRDRITRLGDVQYRVDEDGFLSQRGSDVFDYNSKGQLLRAYN
RGPGGWSVVYHYDGVGRRVSSRNSLGQHLQFFYADLIYPTRVTHIFNHSSSEISSLYYDL
QGHLFAMEVSSGEEYYIASDNTGTPLAVFSSNGQMIKQVQYTAYGEVYLDSNPEFQLVIG
FHGGLYDSLTKLVHFTQRDYDVLAGRWTSPDYSMWPKIGKDPSPFNLYMFKNNNPLSDML
DVKNYVTDVKSWLVMFGFQLSNIIPGFPRHSLYFVEPPYELQAAQHCENEQLVTGVQQAT
ERHNQAFMALEGRLLNKERRRRKNRPGHWFGTSTPIIGRGVMLALKEGRVVAGVSALASE
DSRKVALVLNGAQYLEGTHYIQEGKDCHYFVKVGSADSDLLALGLTNGRKALESGINVTV
SGRSRRGVTVEFAVPSLVLSVRYGLAVDVVDEEKVRLLELARQRALAGAWSKEQQRARDG
KGGSRLWTEGERQQLLTSGKVQGYDGYYVLPVEQYPELADSSFNIQFLRQNEMGKR
Download sequence
Identical sequences H3DEC8
ENSTNIP00000018871 ENSTNIP00000018871 99883.ENSTNIP00000018871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]