SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018881 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018881
Domain Number 1 Region: 794-987
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.39e-40
Family Laminin G-like module 0.00058
Further Details:      
 
Domain Number 2 Region: 370-551
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.05e-39
Family Laminin G-like module 0.0016
Further Details:      
 
Domain Number 3 Region: 585-795
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.46e-38
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 4 Region: 39-235
Classification Level Classification E-value
Superfamily Fibronectin type III 8.78e-33
Family Fibronectin type III 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018881   Gene: ENSTNIG00000015799   Transcript: ENSTNIT00000019109
Sequence length 1011
Comment pep:known_by_projection chromosome:TETRAODON8:12:7472001:7484194:-1 gene:ENSTNIG00000015799 transcript:ENSTNIT00000019109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPTWKGRSLLHLLLLSMCAAPVCFSARRSNVRRSDRLSPPLDIQLETINCSAFSVRWKM
PRRHVSTITGYKVFYTEVRSGRPLGVASATEVPLSLDMLTTDVEIAHLKVNTKYRVSVGA
YGWAGEGRPSMPRDVSTGSHDTCMPPSPPTQPAVMAVSDTELALSWQQGESEGSAPVLHF
LVAYIRPEMDTEWTYIREPIETNSMVLKGLLPETEYQFVVRAVNVHGASPPSHINNPVRT
LATSDGGSGDYGGYITDFRTNDDDRFDIDDSDYDIFIEELKPFPGINQLNTARFKRELKK
ISLSKEKLIFVFFSLKIPSTALPSTTTAATTPTMSPWKGDTPRVYDLTCDDTVCPPDSFC
LSDYDGGGSRCHCNLGWRGNTCSDVVQVTFPRFYGYSHMTFEPLKNSYQTFQITVEFKAE
NEDGLLLYCGENEHGRGDFTSLALVRGKLHYRFNCGTGAAQIVSESGVVVGQWHTVTIFR
DGMSGWLRMDNDTPISGRSQGQYSKITFRSPLYVGGSPTAYWLARATGTNRGFVGCIQSL
SINNRLTDLRAWPVGRALSGADIGECSDSVCEQVYCANGGVCFPNRADGYICLCPLGFRG
PLCAERFSLSSPLFNETVFSYAAVPWPQSSQSYLSFMEFEVTFRPSSPDGTLLYSDDKGS
GDFLAINLVDRYVEFRFDCGSGGATIRSVEQISMDAWHELRVSRTAKSGILQVDSQRPVE
GITEGAFTQIKCSSPLYIGGVPEYDKTKKTAGVEKPFTGIIQKLILNDRTIPITVGPASG
INVANSEHPCVENPCANGGSCRPKWDSYECDCPLGYDGKHCQKAVAEAIEIPQFIGRSYL
TYDSRDILKRVSGSRTNLFMRFKSTAMSGLLLWRGDSPMRANSDFLSLGLQDGALIFSYN
LGSGTVNIAVNGTFNDGKWHRVKAVRDGQSGKLTVDDYGAKTGRSPGKMRQLNINGPLYV
EGGMKEISLHTNRQYSGGLVGCVSHFTLSTDYHLALVEDAADGKNINTCSN
Download sequence
Identical sequences H3DED8
ENSTNIP00000018881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]