SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018930 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018930
Domain Number 1 Region: 265-348
Classification Level Classification E-value
Superfamily E set domains 1.03e-19
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.069
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000018930
Domain Number - Region: 355-403
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0224
Family HLH, helix-loop-helix DNA-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018930   Gene: ENSTNIG00000015845   Transcript: ENSTNIT00000019158
Sequence length 587
Comment pep:known_by_projection chromosome:TETRAODON8:12:6813665:6836095:-1 gene:ENSTNIG00000015845 transcript:ENSTNIT00000019158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGIQEHLIREVSGLKERSLGEEMDPVRSWVRNVGVVDANVAAQSALSGVALSRAHFEKQ
PPSNLRKSNFFHFVLALYDRHGQPVEVERTSFVDFVEHDKEQSGEKTNNGTHYKLQLLYS
NGVRTEQDLYARLIDSVTKQPISYEGQNKNPEMCRVLLTHEVMCSRCCEKKSCGNRNETP
SDPVIIDRFFLKFFLKCNQNCLKTAGNPRDMRRFQVVLSSTVSVDGHVLAVSDNMFVHNN
SKHGRRARRLEPGESVESTMEYATPCIKAISPSEGWTTGGAMVIVIGENFFEGLQVVFGS
MLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFIYTALNEPTIDYGFQ
RLQKVVPRHPGDPEKLAKEILLKRAADLVEALYGNPHSNQDMLLKRAADIAEALYSVPRP
HSQLQALPSSPAHGSVMGLGSYPSQLGVSIGEPGQSSQVGYIRNSSSLSPRGYPSASTPQ
QSGYGGSGGMTGGYGTVPMTSLGVPGSPGFNSASPTGSPYIMPSSPTVPGSSSSSSSLLP
FSSFPSSSKQKSAFAPVLRPQGSPSPACPASGGNSFRALRGLLVPRC
Download sequence
Identical sequences H3DEI7
ENSTNIP00000018930 ENSTNIP00000018930 99883.ENSTNIP00000018930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]