SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018965 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018965
Domain Number 1 Region: 538-601,869-988
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.88e-43
Family Ypt/Rab-GAP domain of gyp1p 0.0056
Further Details:      
 
Domain Number 2 Region: 9-198
Classification Level Classification E-value
Superfamily RUN domain-like 6.41e-34
Family RUN domain 0.00082
Further Details:      
 
Domain Number 3 Region: 965-1083
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.000000199
Family Ypt/Rab-GAP domain of gyp1p 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018965   Gene: ENSTNIG00000015880   Transcript: ENSTNIT00000019193
Sequence length 1093
Comment pep:known_by_projection chromosome:TETRAODON8:12:6404320:6417021:1 gene:ENSTNIG00000015880 transcript:ENSTNIT00000019193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATIMAEADTRQKLLRTVKKEVKQIMEEAVTRKFVHEDSSHIVSFCAAVEACVLHGLKRR
AAGFLRSNKVAALFMKVGKSFAPAEELCKKAQELEQVLGTKRSQSLQSQESLRKMPRLPT
LGPQGVKNLWIRAALFEKVLDKIVLYLVENSSKYYEKEALLMDPVDGPILASLLVGPCAL
EYTKMKTADHLWTDPSADELVQRHRIHGIHCRQDSPTKRPALCIQKRNSSSSMDERPSPS
LSAREYVESLHQNSRVTLLFGKNNVLVQPRDDMEAVPGYLSLHQNADTMTLKWTPNQLMN
GSVGDFDYERSVYWEYAVTIPLEEIVYLHCHQQVDSGGTVVLVSKDGIQRPPFRFPKGGH
LLQFLSCLENGLLPHGQLDPPLWSQRGKGKVFPKLRKRIPQGSGSTDSVSDKEEDEATDY
VFRILFPNSQSAFVTPPDLMDQGSTMWHPTLRKSSCSSCSQGSFSDGTTPKGCNHERAPL
KLLCDNMKYQIISRAFYGWLAYCRHLSTVRTHLSALVNHTIVAPDAPSDACKGLTADVWQ
TFLRDGSTYEEEELLRLVYFGGVEASLRKEVWPFLLGHYQFGMSEDKRNEVDQEVRACYQ
QTMSEWLSCEEIVRQREKEQHAAALAKCSSGASMDSSSQKIIHRDSISNESHSSQSSDRH
SLACLQSDSSNSSTQVFESIEEVEQIETEPKSEEVKQGPKIGNGAAQNGTTSPDSGHPSS
RNFSVTSVLSDGSLTEDNAVPDATPRSGSVSQGTQSPIKPAGAKAEVLPEEPPESKTGAQ
AASTPPFLEKKMEEKSEVLPTKQEDEIPEAQAAEGDAQAEQLGKASPEGTESLLSDEPEM
ENLDPNYDSGHELAKNDTKSETASEIAGTPFTQELLDLYTLNLHRIEKDVQRCDRNYCYF
TAANLEKLRNVMCSYIWRHLDIGYVQGMCDLLAPLLVVLDDEAIAFSCFSELMKRMNQNF
PHGGAMDTHFANMRSLIQILDSELFELMHQNGDYTHFYFCYRWFLLDFKRALRVDKIKSA
HLKSSRPSNTCTLTLTFSLEYKQPLRKLPGVSSRTGAHIIKFFNEMAERHNIKQILSQAR
DLVCKVQMLIENK
Download sequence
Identical sequences H3DEM2
99883.ENSTNIP00000018965 ENSTNIP00000018965 ENSTNIP00000018965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]