SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018967 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018967
Domain Number 1 Region: 11-115
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.12e-17
Family Ankyrin repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018967   Gene: ENSTNIG00000015882   Transcript: ENSTNIT00000019195
Sequence length 601
Comment pep:known_by_projection chromosome:TETRAODON8:12:6388849:6393122:1 gene:ENSTNIG00000015882 transcript:ENSTNIT00000019195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTANISEDIRAKFPLHSAVWENDYRKLEEQIQIPQNDTEAVDPRGRTPLHLAVSLGHLE
SVRVLLRHNASVTKENASNWTVLQEAVSTGDPEMVQLVLQRRDYLKASAALGGVPELLAK
IRESPDFYMEMKWEFTSWIPLLSRVCPSDVCRIWKSGANLRVDATLLGFENMTWIRGRRS
YIFRGDDSCAELMEVNHDNEVVDTERFNISQEMEDVTLESMQPAEQEVAKRLTTPIVNTY
LDTKEIAFERNKSGIWGWRTEKTEVVNGFEAKVFSVNNVNVVIRTRTEHLTDEEKARIKS
ERNILESLLGTVEQHISAQGDMTMEYATATNPTAITPEEYFDPDFELGNRDIGRPIEMSV
RTQKFKGTLWMSEDHPLSLVEQVTPIIDLMARTSSHFARLRDFVTLKFPPGFPVKIEIPL
FHVLNARITFGSVNKCSTDAELKTTPAGTPTPTAEDEEAADLSPFQVCPSVFEVPPSYHR
RGGSRHTPVSSNDEELLQYAIHQSLLESRRASGQEVIWEDTDADVVTRSRSDSNSRSISE
GALVDYGDTSSPSSSMSASSPDTELRLAMELSAQAQAEEDRIRKQEEEELERILQLSLTD
K
Download sequence
Identical sequences H3DEM4
ENSTNIP00000018967 ENSTNIP00000018967 99883.ENSTNIP00000018967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]