SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019024 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019024
Domain Number 1 Region: 28-146,338-668
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.31e-62
Family Integrin alpha N-terminal domain 0.00011
Further Details:      
 
Domain Number 2 Region: 166-359
Classification Level Classification E-value
Superfamily vWA-like 1.71e-48
Family Integrin A (or I) domain 0.00000141
Further Details:      
 
Domain Number 3 Region: 972-1160
Classification Level Classification E-value
Superfamily Integrin domains 6.8e-34
Family Integrin domains 0.0017
Further Details:      
 
Domain Number 4 Region: 670-816
Classification Level Classification E-value
Superfamily Integrin domains 4.24e-24
Family Integrin domains 0.003
Further Details:      
 
Domain Number 5 Region: 818-952
Classification Level Classification E-value
Superfamily Integrin domains 7.85e-21
Family Integrin domains 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019024   Gene: ENSTNIG00000015938   Transcript: ENSTNIT00000019252
Sequence length 1194
Comment pep:known_by_projection chromosome:TETRAODON8:12:5828300:5837866:-1 gene:ENSTNIG00000015938 transcript:ENSTNIT00000019252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADPRPCGLSAAVQVIVVLRVPIWHSRCFNVGTAGAKIFTGPAAEEFGYQVQQATNHEGKW
LLVSAPWSGYSRNRKGDLYKCPVSESRTSCDKLNLQDSLSIPDVKNVNDNTSLGLTLAQN
DGGDLLMCGPLWGQQCSSQRFYPGICARLSPLFQPQPAFSPAVQVCGGPMDVVIVLDGSN
SIYPWEPMTAFIQKLIPSLDIGPQATQLSIIQYGVDPKFEFRLNQYRTKEDALAAASRIT
QMYGHSTNTFQAIQYASQWGFHQNNGGRPEAAKVMVVVTDGESHDVAFRESVLDECDKKG
ITRFGIAVLGYYIRNSIDTENLIAEIKSIASKPTANYFFNVSEEAALSNIAGTLGDRIFN
IEGTGKAGDNFKMEMSQVGFSVHYSSQQAQDVMMLGAVGAYSWSGTVVHQTGSTFNILPS
SAFRETLQDKNHSSLLGYSVTTLNDGRTLYFVGGAPRSNHTGQVIVYTLDAQKQATVIDS
EKGKQIGSYFGSVLCSLDVDRDGVTDLLLVGAPMFMNELKKEEGRVYIFSVTKVTERLRS
SVDSVLTSTIFVLKGVLNELAFLRGSSPTEDARFGMAISAIPDLDLDGYSDVVVGAPLED
NQKGVIYIYNGDKKTLNKEFSQRILGSSLDPKLQYFGRSLDSLKDLNQDSLPDISVGAYG
KVVQLWSRGVATVNAAGSFNPDKINIFNKACDINGGKYSCFTTKLCFTATFRPTNPVGPI
ELSYTLTLDADLQASRVTSRGLFTRNNDRSLTGRMEVRSQQLCLPFQVYVQEAPDFVNSL
SLKVEVQQQNADGNPVLDRSSLSAWEFFIPFTKDCGADEVCTSDLVLSVSSNTQASSAAP
AIIGANNPGLSFQVAVKNKKENAYNSRVLATFSDNLYYSSVFPVTEEVKCTLTPPQTVTC
HVGYPAIQTNKEIKLTLNFDYNLQLVQEKAEVNFEAKSDSKEENPADNRVAVSIPVVYDT
GVIISWEANINFYVVDSPLPAKTAVKTFDDIGPEFNVTAKVSTGNFPVSLLYLSVALPAS
TKAGNQLLYVTGVDTDGGSVTCDSSSLVDPLNIGVKSHTQTFSAESLRQTDKLDCKNAKC
QYLKCILKDIEVNSNYFIKVSTRIWSGTFITATYQSIELTSSISVETTNPDLLLINPKVL
PVALTVSKPGEKGDVPVGVIVGSVIAGLLLLALAVGLLWKFGFFKRKYQQLQKE
Download sequence
Identical sequences H3DET1
ENSTNIP00000019024 ENSTNIP00000019025 99883.ENSTNIP00000019024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]