SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019096 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019096
Domain Number 1 Region: 6-209
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.9e-55
Family Ankyrin repeat 0.00016
Further Details:      
 
Domain Number 2 Region: 223-268
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000732
Family SOCS box-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019096   Gene: ENSTNIG00000016007   Transcript: ENSTNIT00000019324
Sequence length 271
Comment pep:known_by_projection chromosome:TETRAODON8:13:10259204:10260391:-1 gene:ENSTNIG00000016007 transcript:ENSTNIT00000019324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLGFWTDRSAVHEAAAEGRVVQLQRLIEDGAAVNMVAVDSITPLHEACIRGQAQCVRLLL
GAGAQVEARNIDGSTPLCDACAAGSLECVKLMLEYGATVNPPLFTFSPLHEACMSGNSEC
VQLMIDRGALMEAHDCHYGTPLHVACAREHLDCAKVLLNAGANVNAAKLHETALHHAAKM
KNVDLIELLVEFGANVYARDNLKRKPINYTSLGSPSYLCLEFYENTPLSLQQISRVAVRR
AVGKRAAEVLSQLELPGRIIRFLSYMPPQIF
Download sequence
Identical sequences H3DF02
ENSTNIP00000019096 ENSTNIP00000019096 99883.ENSTNIP00000019096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]