SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019125 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019125
Domain Number 1 Region: 1958-2056,2147-2173,2325-2375,2498-2564,2706-2726
Classification Level Classification E-value
Superfamily Sialidases 0.000000981
Family Sialidases (neuraminidases) 0.049
Further Details:      
 
Domain Number 2 Region: 545-603,702-763
Classification Level Classification E-value
Superfamily Sialidases 0.0000118
Family Sialidases (neuraminidases) 0.025
Further Details:      
 
Domain Number 3 Region: 2349-2421,2475-2551,2685-2842
Classification Level Classification E-value
Superfamily Sialidases 0.0000504
Family Sialidases (neuraminidases) 0.025
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000019125
Domain Number - Region: 900-932,1072-1133
Classification Level Classification E-value
Superfamily Sialidases 0.000147
Family Sialidases (neuraminidases) 0.058
Further Details:      
 
Domain Number - Region: 1525-1549
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000875
Family Integrin beta EGF-like domains 0.062
Further Details:      
 
Domain Number - Region: 430-455
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00121
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 788-814
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0014
Family EGF-type module 0.058
Further Details:      
 
Domain Number - Region: 1277-1332,1438-1478,1788-1815
Classification Level Classification E-value
Superfamily Sialidases 0.00167
Family Sialidases (neuraminidases) 0.058
Further Details:      
 
Domain Number - Region: 2240-2265
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00261
Family Integrin beta EGF-like domains 0.023
Further Details:      
 
Domain Number - Region: 335-408,543-577
Classification Level Classification E-value
Superfamily Sialidases 0.0118
Family Sialidases (neuraminidases) 0.028
Further Details:      
 
Domain Number - Region: 2968-2994
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0484
Family Integrin beta EGF-like domains 0.039
Further Details:      
 
Domain Number - Region: 2591-2619
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0865
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019125   Gene: ENSTNIG00000016036   Transcript: ENSTNIT00000019353
Sequence length 3194
Comment pep:known_by_projection chromosome:TETRAODON8:13:10713305:10735413:-1 gene:ENSTNIG00000016036 transcript:ENSTNIT00000019353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TVPLNTSTASVLQFALGSGSCRFSYADPSIIVSYSLTGTTNTSDDWVTLEKIRAPTNSTT
VIHLLPLPHHSKADGVRFRWTQEAPQGPEGYESCWGLDNVLLVNAAHRPPLLEDNLDPPN
TANWLFFPGATVKHACQSEGNTLYFHGSETVAQSFASTRDIDLHREEGRSYWEEDFESLP
SSWDIEGAVIGNQCGEIESGSALVFEKEGRRRVCTPYIDTTSYGNLRFYFTMGGGDCDPG
ETHENDVIVYGKSEGRRERVVLDTLPYSSYRTPAVVSLALPTDLQTPVTKFCLEQRSHGG
PDRHVWAMDFMQLLPVLPGTHTHLAQFSINLGCGSYQPANSVSLEFSTNQGRSWSLLHTE
CLPELCAGPHLPHSTIYSSDNYSGWTRISIPLPNAALTDATRFRWKQSGTVAGSMWAIDN
VYIGPACLRFCSGRGHCSRTGCKCDPGFSGPACELASQTFPAFLSEGFSSPRLSSYHSFS
SLRGAEVSFGCGVLASGKALVFNRDSRRHLVTTPLDSSQARYLQFTLRLGSRSTLSSCPA
PDQPGEGVLLHYSSDNGITWTLLQHYAYQGFHEPRIVSVELPSGARKFGVQFRWWQPYHS
GRGQDVWALDEISMTSVLFNTISLDFSNVLDVTQSLGFYLGHVQPYCQHDWTLSFSGEPS
PGSIIRYVETQSMQIGASYSLQFSLVMGCGREPSPHIDTQVRLEFSTNHGLTWHLVKEAC
LPGMPSCSEFTAPSVYHPSEFKNWRRITLSLPQKTWSSATRFRWIQNYYGEQDEWALDDI
YIGQQCPNMCHGHGWCDHGHCRCDDGFSGTDCQPSSPLSSSVLSDFESQDALLATWQEVI
GGEVVTPDMGCGVVSSGSSLYFSKAGLRQLMSWDLDTEWAEFVQFYLRVGGDWAECNQAD
SREEGVLLQYSNDGGISWGLIAEMYFTDFTKPRFVHYELPLASKTPSTRFRWWQPLHSGE
GYDQWAIDDVIILSEREKHIIPMANPTLPQNFYEKPAFDYPLNQMSVWLMLGNEGMERES
NDIPTPSAMVFGRSDGDRVAVTRDLALRHGYTLQFKLNIGCESEFSAAAPVLLQYSHDAG
RTWALVREGCYPGTPGSGVCEGSGRELREPTVYNTGDYEQWTRVTVVIPRNVAASKTRFR
WFQESSVYREAPPFALDGVYISEPCPNHCGGHGDCISGVCFCDMGYTVEQDSCVPSVASP
TELTEGFEGKLSPLWQSLSGGQIGGGCGIISEGKALYFSSPGRRELRTVPLDTSNTRLVQ
FYIRIGSKSLGPTCTRPRSRNEGVIVQFSTNNGVQWQFLRELDFSSFLEPQVVTIELPSA
AKTPYTVFRWWQPQQGKHSAQWALDDVLIGMNDSSRTGFQDKFDGTTPLRHNWYRVQGGE
VTVDCLSLDTALTFNSVAIDKKPRYAETWDFEVSGSSFLQFELSMGCSKSTSFSHGVRLE
YSTDCGQHWSLITPECVPPAIGCSGYTQSSIYTSTQYKHWRRITVYLPSAANSPRTRFRW
IQTHFTPGAEGWALDNVLLAPGCPWMCSGHGLCDNGRCVCDKGYGGQHCVPVTPLPSVLR
EDFNDNLQQETWPELYGAERGTLSGEPLKSGTALIFKGDGMRMIVSRDLDCTNTLYIQFS
FKFITKGVPERSHSILLQYSVNGGISWLMLDEFYFPTSTDTLFLHLALPASAQTNATRFR
LWQPYNSGKKEEVWVIDDLIIDGSTLHNPPVVIDSFDEGPNDSNWLFFPGGNTGLYCPYQ
KTGLEEDESAMVFLSSELGEHSITTRDIEVNENTIIQFEINVGCTVESSSNYPVRLEFSR
DFGATWHLLVPLCAGAPQPSALCSTELHPASIYFPGTTQGWRREVIHFGKLRLCGSVRFR
WYQGFFSSGSSPPTWALDNIYIGPQCQDMCNGHGACVGGTHCACDPGYSGSDCSVPDTPN
PDFLKEDFEGGAVDAEHFRLLSGGKPSRKCGIMSSGNHLFFSEDGLRMLVTNDMDLSNAR
FVQFFLRLGCGKAAPDPRSQPVLLQFSVDGGLSWGLLQEFLFSNSSNQARLVALEIPLRA
RTTSTRIRWWQPSESGHFYSPWVIDQVVVGGSASGWGPLEDDFSSIDGRSWLLHPGGTRM
PVCGSDGPAFAFIEKSNTRYAVTTDISLGQDAFIQFDFSASCSVTNSCYSVELEYSLDLG
LSWQPLVRDCLPTSPDCSSYTLQRLLVSDTYNKWGRITLPIPSYARSPATRFRWLQQAPF
DKQQTWALDNLYIGDGCPDMCSGHGHCKQSSCVCDSEWGGEYCDEPVVPLPSQLKDSFSR
APSLSHWHTLTGAKLSTVCGAVASGAALHFSGGCSRQLVTVDLNLTNAEFIQFYFMYGCM
IPPSNRNQGVLLEYSLNGGINWHLLTEIFYDLYTKPGFVNVLLPPAARQEGVRVRWWQPQ
HDGVDHSDWALDNVLIAGSDPRAQISDTFGGVALPNHERSPADGASGRIDQPNEQEETPI
VSDHWLFSEDCSVQRFCSSPDGVMVCGNTDGREVYAVTHDIVPDKDWVMQFKIAVGCSVP
ERHADRQVHVQYSVDFGVTWKYLVPQTLMIMFTLVVGITRGLFSSAVRFRFYQQHSDIQW
GVENFYIGPACESHCGGHGDCLDQRCLCDPGFTGPNCYASSTLKASLKERFDWEGTSSPQ
WQVLEGGRPCTDCGVLVEGTALYFGGADARHAVTADLDLRGAKFVEYWARIGSEDNMTLC
HRPTCRKEGVLLDYSTDGGVSWTLLHEMDYLKYVSVRRDYIVLPEGALTNATRLRWWQPF
TISSGLATPSLERAQWAIDNILVGGSDINPSTLLDTFDDEGVSHEESWSFYPNAVRTGFC
GNPSFHLYWPNKNQDRTHNILATRELIVQPGYILQFKIAVGCEADTCEDHHSVLLQYRKD
ARSDSWQVVQSECLPSSVNNVGCSPFQFHESTIYSPVNSSTWTRVTVQLPDHVSSGATQF
RWIQKEGSGERQSWAVDHVYIGEACPGLCSGHGYCTSGSVCICDEGHHGDDCSLSSNDLP
SSIKDNFESGGVSPESWQSIQGGGVGNGCGQLSPHAHGDSLYFNGCKMRQAVTKPLDLTR
ASKIMFVLQIGSVAQTDSCNIALDQADTVDRAVLLQYSVNNGISWHVIAQHQPKDFIKAQ
RVSYNIPLEARVKGVMLRWWQPRHDGAGHDQWALDHVEVVLLYTRKQNYMMNFARQSGAR
HYYSRKKRALLQRA
Download sequence
Identical sequences H3DF31
ENSTNIP00000019125 99883.ENSTNIP00000019125 ENSTNIP00000000673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]