SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019126 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019126
Domain Number 1 Region: 277-439
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.31e-45
Family SPRY domain 0.00016
Further Details:      
 
Domain Number 2 Region: 72-130
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000244
Family B-box zinc-binding domain 0.0023
Further Details:      
 
Domain Number 3 Region: 8-60
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000158
Family RING finger domain, C3HC4 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019126   Gene: ENSTNIG00000016037   Transcript: ENSTNIT00000019354
Sequence length 439
Comment pep:known_by_projection chromosome:TETRAODON8:13:10792965:10796745:1 gene:ENSTNIG00000016037 transcript:ENSTNIT00000019354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGASLDTPAECPLCSLPTSELVTLKCKHRFCRRCIEALWSKSPDGPYECPLSRCSEHLRP
HLDSPVFQNHSLVPPTKDISSWRCLEHQEIKRIYCRQCAVCVCMVCTVIGSHCGHLCISI
KEAERELRLQQTEEKLNSRLEDLTQMKEASTVVLDEAQMSVRQQYAAIREALDEEEQVAL
GCVKKEEGRVLGGLEEKLAHLRSVLESTQRSLHILEGLADTRGDNHIGDQAFIVSRCHGE
LRGAVPGARRTTKKKSPIGNVVSFKPLSACADGCVPSLDANTAHPRLQLSNNNRTVTYSD
TQQPYTDHVTRFSSFPQVLASSALQGGPWYWEVKVSADEGRWKVGVCEGQIERKGQKDSS
RLGCNPYSWCLACDKNRVEALHDKVSEPVAVDGLQKVGVLLNFEEGVLSFFNVAPGGSLA
LMHSYHHSFAGPVFPAFSV
Download sequence
Identical sequences H3DF32
ENSTNIP00000019126 99883.ENSTNIP00000019126 ENSTNIP00000019126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]