SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019158 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019158
Domain Number 1 Region: 141-233
Classification Level Classification E-value
Superfamily SAND domain-like 1.26e-29
Family SAND domain 0.00093
Further Details:      
 
Domain Number 2 Region: 440-481
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.000000000145
Family MYND zinc finger 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019158   Gene: ENSTNIG00000016068   Transcript: ENSTNIT00000019386
Sequence length 504
Comment pep:known_by_projection chromosome:TETRAODON8:13:11241917:11245420:1 gene:ENSTNIG00000016068 transcript:ENSTNIT00000019386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EGSDTESEAEVTTMAVMAEPGNIDIGAESLPNPDEAEAAFAVADVTTVTVGDVQAAEDNV
FTTTVATSDSLPEHMLSGRTTLQLGEGLSTQKATLIVVHTDGSLVEAAGLKPAAAMASPG
PQTPPTPLSPPQVKESCSKYNWDPSVYNNELPVRCRNTSGVLYKNRLGSGGKGRCIRHSQ
QWFSPTEFEGLAGRASSKDWKRSIRYAGRPLLCLIQERILNPHAASCTCAACCDDLAETG
PVRLFVPYKRRKKDESAVSPPKKLPVAKNITLAPGTTSVTVSPSGQFTTSGTLTFDRTPA
GDIISEGSAQSEVFTSTAGGWRCTGPGAPGSEFNTHQLPRSSSSAVLAALPALAVSPQPV
HAKMTGAASPSNGLMSSLEVGPVGGSAPVVSEAQKNTWMYLEELANTLLSNMQQLKALIE
QAKNASGDIAGVRGHGGRKEQMCVNCGRVAISECTGCHKVNYCSAFCQRKDWKDHQHICC
QSSGGVAVHEDEHITPMDMDKVSL
Download sequence
Identical sequences H3DF64
ENSTNIP00000002355 ENSTNIP00000019158 99883.ENSTNIP00000019158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]