SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019165 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019165
Domain Number 1 Region: 23-149
Classification Level Classification E-value
Superfamily PH domain-like 9.73e-49
Family Phosphotyrosine-binding domain (PTB) 0.00011
Further Details:      
 
Domain Number 2 Region: 487-546
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000184
Family SH3-domain 0.00023
Further Details:      
 
Domain Number 3 Region: 681-740
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000017
Family Pointed domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019165   Gene: ENSTNIG00000016075   Transcript: ENSTNIT00000019393
Sequence length 766
Comment pep:known_by_projection chromosome:TETRAODON8:13:11289991:11297752:1 gene:ENSTNIG00000016075 transcript:ENSTNIT00000019393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SKSSAKALYEQRKKYSNSNFIMHETSQYHVEHLSTFIMDKAESIVTVDDAIKKLVLLDSK
DKIWTQEVLLQVTDKAVRLLDCDTQEELENFPLSIIHLSQTVLNKTRYPSVLLLICQDKD
QHKPDIHFFHCDEVDAEIVHADIDSAIGDNKHGKKMRPQTLKVNQEKMKHRRETILPPAA
PAPAAKGRVATSSLFTRGAIVCVLGADRRGSGKHEPESHDKLIQRIEIDVQVLNCTLDDI
EVFMSRLQKAAEAFAQLNHRNKSKKNKKKGPAEGMLTLRAKPPSEAEFIDSLQKLKLAFN
LLAKLKKHIENPSASELVHFLFGPLEMVLKTLGSPDLARSIVSPHLSRDTVDFLLGHLTP
KETGIFELLGDGWTKPRAEWPRDRCAPPYFPKFRNGWEAPVDYIRAASWETEGPPEALGP
PTSPVYRQQSAEDVRTAELSLLQPAFPLSDLSYRVRHRSFPPFLAHVHTPVNETSPVRSY
NGMSATTRKYAKICYQFVARNANELSVLQDEVLEVIEDGKQWWKLRNRSGQTGYVPFNVL
EVVKAEVSGAGRRTRQHILSLARRQKSFSLRPKTNLFWRKYKPVVELCSCVCGVCVRSKA
SGRPLLLRSETASTRGDTKTNVSKRLNKRRTARRSVSAAGMDEVNTELLLMITANKSQPP
VRKLRYERPSGIQVPLTYESNTEQVTAWLSSKGFSKPAVECLGILTGAQLFSLNKDELRA
VCGDEGSRIYSQITVQKEQVEQKCGSSELQEVLSRRQQNIRSSSGD
Download sequence
Identical sequences H3DF71
99883.ENSTNIP00000019165 ENSTNIP00000019165 ENSTNIP00000019165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]