SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019171 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019171
Domain Number 1 Region: 45-275
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.59e-58
Family Ankyrin repeat 0.0000000452
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019171   Gene: ENSTNIG00000016080   Transcript: ENSTNIT00000019399
Sequence length 1015
Comment pep:novel chromosome:TETRAODON8:13:11388386:11397357:1 gene:ENSTNIG00000016080 transcript:ENSTNIT00000019399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AKQRRQDQLQRWLGSETDRTGSEARDTLSASGTRRAKVRFAQGAVFMAACSAGDREEVAA
LLRQGADINHANIDGLTALHQACIDENAEMVQFLVESGSDINRGDNEGWTPLHAAASCGF
IQIVKFLIEHGAHVGAVNSEGELPLDVATEDAMERLLKEEIKKQGIDVDKARKEEERVML
QEATAVLAGGGTLLPHPNTKATALHVASAKGYIEVLKVLLRCGVDVNSRDVDGWTPLHAA
AHWGQEEVCGLLADSMCDMGAVNNVGQTPLDVADENLADALEELQKKQNALRSEKEKQTP
VIDTSQQIPIVPVRARRTSISRMSSKEKICLHEREKHPSPALPSGPVEDEEEEGQTGQGQ
PQSQGKASSSSSSEEESESESDAESEKAKNRELINNLNNKRNTSGLLPTSMSLSSAVSQM
KKVKEVGHQASLRATKDLTKPPTGEAPGSWRTSLRKAGSSVTLGSAELTDSSQEQSRVPD
PGLGMTRSASSPRLSSEAEAKVNAVSSEPRLARVPPIPTRRLFSIPDSSPESSNRWVLCP
CPQSSSLHNLSELLQTCSRPSWLSRSSSYTRRLPSQPGNDFTSSTPSLLHRSVVQPAAPQ
LFVLFLVIGCEPETSSYGKRLDDPSVTSANTGTSASGLGHLNSVLSQSYLKTSFSPRLPQ
EQKDPSAVTSANSQAPTAGEQETKQRRKSYLTPVRDEEAEAQRKARSRHARQSRRSTQGV
TLTDLYVPLIGLHSSHVTSLSRRTWCLQEVSWRSRIASLQKSDLLGLTQPSGSSRPPAAD
KKGAHLPLKEDFSAYNSPLTCLIFTDAEASTGENEMERWARERRERRQARARRKAQRTGE
FLCRVQSDDNEPSGEEEFSGIFTHSVSRSDSVISDLCSCTPSGRTARVTTAPLEGRPKTL
KRYPLSQIILLCSLRSVQLFEEVSRENSQLQSQLQDTQRVVSQTRLELEKATQRQERLSD
CSALLELERKDRRMLERRLGELEEELKVLVDLRADNQRLKDENGALIRVISKLSK
Download sequence
Identical sequences H3DF77
ENSTNIP00000019171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]