SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019221 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019221
Domain Number 1 Region: 87-244
Classification Level Classification E-value
Superfamily E set domains 2.94e-53
Family RhoGDI-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019221   Gene: ENSTNIG00000016130   Transcript: ENSTNIT00000019450
Sequence length 248
Comment pep:known_by_projection chromosome:TETRAODON8:7:8290897:8295504:-1 gene:ENSTNIG00000016130 transcript:ENSTNIT00000019450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYSCTNRGNSQDPSSAKDAAGDNPGRDTGGTDASPKQTAAMKVKKGCNSAEVGVPVTTE
EDLLSSAVITPEDVLGLQKITENYLCSPDENIFSIDFTRFKIRDMETGTVLFEITKPPTT
DKTGDKRDIDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDLPIENFRMIERHYFRERLL
KSFDFEFGFCMPRSKNTCEHIYEFPPLSEDSIQEMILHPYETQSDSFYFVDNKLVMHNKA
DYSYNGGR
Download sequence
Identical sequences H3DFC7
ENSTNIP00000019221 ENSTNIP00000019221 99883.ENSTNIP00000019221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]